SecReT6
Protein ID: 307545498
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2908
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2229578..2229865 [-]
Producthypothetical protein
NotePAAR
UniProt IDE1V3W3
KEGG IDhel:HELO_2908
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.00E-19, Aligned region: 20..89
DUF4150 [PF13665], Evalue: 0.00017, Aligned region: 23..44
DUF4150 [PF13665], Evalue: 0.00017, Aligned region: 61..79
Protein Sequence: 95 a.a.     [Download]
>gi|307545498|ref|YP_003897977.1| unnamed protein product [Halomonas elongata DSM 2581]
MGRKFVLLGDLGTDHEGFPPTPVTAGSPTVMIDGKPVARQGDPLAPHDKPDHGPHPRAIAGGSGSILVDG
KPVALTGDAVDCGGVVIGSSSGEGS
 
Nucleotide Sequence: 288 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2229865-2229578 Halomonas elongata DSM 2581 chromosome, complete genome
ATGGGACGCAAGTTCGTATTGCTGGGGGATCTCGGCACCGACCACGAGGGTTTCCCCCCCACGCCGGTGA
CCGCCGGCAGCCCCACGGTGATGATCGACGGCAAGCCGGTGGCTCGTCAGGGTGACCCTCTGGCGCCTCA
CGACAAGCCGGATCATGGCCCCCACCCGCGCGCCATTGCCGGCGGCTCGGGCAGCATCCTGGTCGATGGC
AAGCCGGTGGCGCTCACCGGCGATGCCGTGGACTGCGGCGGCGTGGTGATCGGCTCCTCCAGCGGGGAGG
GTAGCTGA