SecReT6
Protein ID: 307545501
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2911
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2234194..2235633 [-]
Producthypothetical protein
NoteTssA
UniProt IDE1V3W6
KEGG IDhel:HELO_2911
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-13, Aligned region: 49..108
ImpA-rel_N [PF06812], Evalue: 4.10E-13, Aligned region: 441..462
Protein Sequence: 479 a.a.     [Download]
>gi|307545501|ref|YP_003897980.1| unnamed protein product [Halomonas elongata DSM 2581]
MRITQSNQLEPLLAPLAEGVGEPVTSHEDYDWLDEEMMKVGSLQHGEVDWAGAETRAARLLAEHGKDLKV
LGHLLHCLQHDADPVRFALSLELLVGALDGWWVEAYPFAGPRGKRARPKLFQQFAQRALKLAGSLNFLGA
AEEHAACREGLARLRDRAADHELPDEPLADLTRLLEQATPSASEPTTATSSGTSASGTDTAGAATPPREA
DTEAPRAPEARLEAGNERGNRQALLKMADFLNEQSPGEALGYRLRRHAVWHAIQGLPMTRDGQRTELAPV
SADRVTEYREVATGRPTLEDWQRIENSLALSPYWLEGHRLSAEVARRLEHPRCAEAIREETARFVDRLPG
IEALTFSDGTAFLDAETQTWLAETSGPGSPVAPMGDGDPWQAGLETARERLAEEGLAPALGVLDEGLAAS
GSPREEVYWRLASADLLHEAGLVALARQHYQALHDVVASLELERWEPALPVRLSAALGT
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2235633-2234194 Halomonas elongata DSM 2581 chromosome, complete genome
ATGCGCATCACCCAATCCAACCAGCTCGAGCCATTGCTCGCGCCTCTCGCCGAGGGAGTCGGCGAGCCGG
TGACCTCGCACGAGGACTATGACTGGCTCGACGAGGAGATGATGAAAGTCGGCTCGCTGCAGCATGGCGA
GGTCGACTGGGCCGGTGCCGAGACGCGGGCCGCGCGGCTGCTTGCCGAACACGGCAAGGATCTCAAGGTA
CTCGGCCACCTGCTGCATTGCCTGCAGCACGACGCCGATCCGGTGCGCTTCGCGCTGTCACTGGAACTGC
TGGTCGGTGCCCTGGATGGCTGGTGGGTCGAGGCTTACCCCTTCGCCGGGCCGCGTGGCAAGCGGGCTCG
GCCGAAGCTGTTTCAGCAGTTCGCCCAGCGCGCACTGAAGCTGGCCGGTTCTCTGAACTTCCTGGGGGCT
GCCGAGGAACATGCGGCCTGCCGTGAGGGACTGGCGCGACTGCGCGACCGGGCCGCCGACCATGAGCTGC
CGGATGAGCCGCTGGCCGATCTGACCCGTCTGCTGGAGCAGGCCACGCCCTCGGCGTCGGAGCCAACGAC
AGCGACATCTTCGGGGACGAGCGCGTCCGGCACCGATACGGCCGGTGCGGCAACGCCTCCCCGGGAGGCC
GACACCGAAGCACCCCGCGCGCCGGAGGCACGGCTCGAGGCCGGCAATGAGCGCGGCAACCGCCAGGCAT
TGCTCAAGATGGCCGACTTCCTCAATGAGCAGTCGCCGGGCGAGGCGCTCGGCTATCGACTGCGCCGGCA
TGCAGTCTGGCACGCCATCCAGGGGTTGCCGATGACGCGCGATGGCCAGCGTACCGAGCTGGCGCCGGTA
TCTGCCGATCGGGTCACGGAGTATCGCGAGGTCGCGACAGGCCGACCGACGCTCGAGGACTGGCAGCGCA
TCGAGAACAGCCTGGCGTTGAGTCCCTATTGGCTGGAGGGGCACCGGCTGAGTGCCGAGGTGGCCCGGCG
ACTCGAGCATCCCCGTTGCGCCGAGGCGATTCGCGAAGAGACGGCCCGTTTCGTTGATCGTCTACCGGGT
ATCGAGGCGCTGACCTTCAGTGACGGCACCGCCTTCCTCGATGCGGAAACGCAGACCTGGCTGGCGGAGA
CCTCCGGTCCCGGCTCGCCCGTGGCCCCGATGGGTGACGGCGACCCTTGGCAGGCCGGCCTCGAGACGGC
CCGCGAACGGCTTGCCGAGGAGGGGCTGGCGCCGGCGCTGGGGGTACTCGACGAAGGCCTGGCGGCCTCG
GGGTCGCCCCGCGAGGAAGTCTACTGGCGCCTGGCCAGCGCCGACCTGTTGCACGAGGCCGGGCTCGTTG
CCCTGGCCCGGCAGCACTATCAGGCATTGCATGATGTCGTGGCGAGCCTCGAGCTGGAACGCTGGGAACC
GGCACTGCCGGTGCGGCTGTCGGCGGCGCTCGGGACATGA