SecReT6
Protein ID: 307545504
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2914
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2237928..2240549 [-]
ProductATPase AAA
NoteTssH
UniProt IDE1V3W9
KEGG IDhel:HELO_2914
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.30E-38, Aligned region: 610..771
AAA [PF00004], Evalue: 2.50E-19, Aligned region: 222..339
AAA [PF00004], Evalue: 2.50E-19, Aligned region: 616..733
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 222..245
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 280..352
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 615..736
AAA_16 [PF13191], Evalue: 2.00E-13, Aligned region: 199..244
AAA_16 [PF13191], Evalue: 2.00E-13, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 2.00E-13, Aligned region: 466..548
AAA_16 [PF13191], Evalue: 2.00E-13, Aligned region: 586..656
AAA_16 [PF13191], Evalue: 2.00E-13, Aligned region: 680..709
AAA_16 [PF13191], Evalue: 2.00E-13, Aligned region: 770..830
ClpB_D2-small [PF10431], Evalue: 4.40E-13, Aligned region: 777..852
AAA_22 [PF13401], Evalue: 2.60E-09, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.60E-09, Aligned region: 614..708
AAA_25 [PF13481], Evalue: 8.90E-06, Aligned region: 222..294
AAA_25 [PF13481], Evalue: 8.90E-06, Aligned region: 393..504
AAA_25 [PF13481], Evalue: 8.90E-06, Aligned region: 608..648
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 222..269
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 467..493
AAA_17 [PF13207], Evalue: 9.90E-05, Aligned region: 616..676
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 190..241
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 616..656
NACHT [PF05729], Evalue: 0.00032, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.00032, Aligned region: 616..643
AAA_14 [PF13173], Evalue: 0.0008, Aligned region: 222..303
AAA_14 [PF13173], Evalue: 0.0008, Aligned region: 615..703
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 202..240
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 274..305
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 616..653
Arch_ATPase [PF01637], Evalue: 0.001, Aligned region: 686..697
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 163..187
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 366..402
AAA_19 [PF13245], Evalue: 0.0015, Aligned region: 607..637
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 222..249
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 478..524
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 616..653
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 786..803
AAA_29 [PF13555], Evalue: 0.002, Aligned region: 217..239
AAA_29 [PF13555], Evalue: 0.002, Aligned region: 613..627
MobB [PF03205], Evalue: 0.0026, Aligned region: 222..246
MobB [PF03205], Evalue: 0.0026, Aligned region: 615..637
Sigma54_activat [PF00158], Evalue: 0.0048, Aligned region: 220..240
Sigma54_activat [PF00158], Evalue: 0.0048, Aligned region: 615..713
IstB_IS21 [PF01695], Evalue: 0.0053, Aligned region: 216..247
IstB_IS21 [PF01695], Evalue: 0.0053, Aligned region: 615..626
TIP49 [PF06068], Evalue: 0.0098, Aligned region: 223..261
TIP49 [PF06068], Evalue: 0.0098, Aligned region: 270..302
TIP49 [PF06068], Evalue: 0.0098, Aligned region: 614..650
Protein Sequence: 873 a.a.     [Download]
>gi|307545504|ref|YP_003897983.1| unnamed protein product [Halomonas elongata DSM 2581]
MLRVELPALIGRLNAIARQGLEGAAALCAEQQAPEVGVSHLLLAYLDQPLCDLRVLLDAEAIEPEALRRA
LTEDARPPRDLEVATPSFSPLLVELLQDAWLLASTELEHRELRTGVIFTALLHHAGRYLGPQGERLLSGI
NRERLRRDFVRLTRDSAEAAVAEDVQPARAGGAAGDDSALARFATSLTEQARRGELDPVLCRDPEIDQML
DILGRRRKNNPIVVGDAGVGKSAVVEGLASRIVEGRVPSALAGVELVSLDLGALQAGASVKGEFEKRLKA
VIEEVKEAAVPTLLFIDEAHTLIGAGNPEGGADAANLLKPALARGELRTIAATTWREYKKHIEKDPALSR
RFQPVALGEPDVEQALVILRGLRDVYESTHGVLIGDSGLRAAAELSARYLAGRQLPDKAIDVLDTAGTRL
AQALDTPPRRLSHLMSEQLAAQREHDQLEREALLGRTPDATRRDALAERLARLDEERETLEAAWREQRDC
VDAILTLHRELLDDEGDDDESDAAETRERRTAELAGHEARLAELQREFSLVNASVEEAQVAQVIGDWTGV
PVERMTRDELARLTELPDELGRLIKGQDTAIERLHRHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVV
QIAESLYGGRQFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGLLTEAIRQRPYSVVLLDEVEKAHPDV
LNLFYQAFDKGELADGEGRVIDCRNVLFFMTSNLGYEAVVRHADDHEAMDAALYPVLADFFKPALLARME
VVPYLPLSRDILHDIVSAKLETLAGRIRDRHRQAEVVLEPTLAEAICARATRSENGARMLESIIDGELLP
PVSRALLECMARQEPVARVALGVDEHGFTAEVG
 
Nucleotide Sequence: 2622 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2240549-2237928 Halomonas elongata DSM 2581 chromosome, complete genome
ATGCTCAGGGTAGAGCTTCCGGCACTGATCGGCCGACTCAACGCCATCGCCCGCCAGGGACTGGAAGGGG
CTGCGGCACTGTGCGCCGAACAGCAGGCGCCCGAGGTAGGCGTTTCCCATCTGCTGCTGGCCTACCTTGA
CCAGCCGTTGTGTGACCTGCGGGTGCTCCTCGATGCCGAGGCGATCGAGCCGGAGGCGCTGCGCCGTGCA
CTCACCGAAGACGCCCGACCGCCCCGCGACCTGGAAGTGGCCACGCCGAGTTTCTCGCCGTTGCTGGTCG
AGCTGCTGCAGGACGCCTGGCTGCTGGCGAGTACCGAACTCGAGCATCGCGAACTGCGCACCGGGGTGAT
CTTCACCGCTCTGCTGCATCATGCCGGCCGTTACCTGGGGCCACAGGGCGAGCGGCTGCTTTCCGGGATC
AATCGCGAGCGGTTGCGTCGCGACTTCGTCCGGCTGACCCGCGACTCCGCCGAGGCCGCCGTGGCCGAGG
ACGTGCAGCCGGCTCGCGCCGGTGGAGCGGCCGGCGATGACAGCGCCCTGGCACGCTTTGCCACCTCGCT
GACCGAGCAGGCGCGTCGCGGCGAGCTCGACCCGGTACTGTGCCGCGACCCCGAGATCGACCAGATGCTC
GATATCCTGGGCCGGCGCCGCAAGAACAATCCCATCGTGGTGGGCGACGCCGGGGTCGGCAAGAGCGCCG
TGGTCGAGGGGCTGGCATCACGCATCGTCGAGGGTCGCGTGCCTTCGGCGCTGGCCGGCGTCGAGCTGGT
GTCGCTGGACCTCGGCGCCCTGCAGGCCGGGGCCTCGGTCAAGGGCGAGTTCGAGAAGCGCCTCAAGGCG
GTGATCGAAGAGGTCAAGGAGGCCGCTGTCCCGACGCTGCTGTTCATCGACGAGGCCCACACGCTGATCG
GCGCCGGCAATCCGGAAGGTGGTGCCGATGCTGCCAACCTGCTCAAGCCGGCATTGGCGCGTGGTGAGTT
GCGCACCATCGCCGCCACGACCTGGCGCGAATACAAGAAGCACATCGAGAAGGATCCGGCGCTGTCGCGG
CGTTTCCAGCCGGTTGCCCTGGGTGAGCCGGACGTCGAACAGGCGCTGGTGATCCTGCGTGGCCTGCGGG
ACGTCTACGAGTCGACCCATGGTGTGTTGATCGGCGACAGCGGTCTGCGTGCCGCCGCCGAACTCTCGGC
GCGCTACCTGGCTGGACGCCAGTTGCCGGACAAGGCCATCGACGTTCTCGACACCGCCGGTACCCGGCTG
GCCCAGGCGCTGGATACGCCGCCACGCCGACTCAGCCATCTGATGAGCGAGCAGTTGGCCGCCCAGCGCG
AGCACGACCAGCTCGAACGCGAGGCGCTGCTGGGCCGCACCCCCGATGCCACCCGGCGCGATGCCCTGGC
CGAACGTCTGGCCCGGCTGGACGAGGAACGCGAGACCCTGGAGGCTGCCTGGCGCGAGCAGCGCGATTGC
GTCGATGCCATCCTGACGCTGCATCGCGAACTGCTCGATGACGAAGGCGACGACGATGAGAGCGACGCCG
CCGAGACACGCGAACGGCGGACAGCGGAGCTGGCCGGGCACGAAGCGCGCCTTGCCGAGCTGCAACGCGA
GTTTTCCCTGGTCAATGCCAGTGTCGAGGAGGCCCAGGTCGCCCAGGTGATCGGCGACTGGACCGGCGTG
CCGGTGGAGCGCATGACTCGCGATGAGCTGGCGCGACTCACCGAGCTGCCGGATGAACTGGGACGGCTGA
TCAAGGGCCAGGACACGGCCATCGAGCGCCTGCACCGCCATCTGCTCACCGCCCGCGCCGACCTGCGTCG
CCCCGGCCGTCCGCTGGGGGCCTTCCTGCTGGTCGGACCCAGTGGGGTAGGCAAGACCGAGACCGTGGTG
CAGATCGCCGAGAGTCTCTACGGTGGCCGCCAGTTCCTGACCACCATCAACATGTCGGAGTATCAGGAGA
AGCACACCGTCTCGCGGTTGATCGGCTCACCGCCCGGTTACGTGGGCTTCGGCGAGGGTGGTTTGCTGAC
CGAGGCGATTCGCCAGCGGCCCTATTCGGTGGTGCTGCTCGATGAAGTCGAGAAGGCCCATCCGGACGTG
CTCAACCTCTTCTACCAGGCCTTCGACAAGGGCGAACTGGCCGATGGGGAAGGGCGCGTCATCGATTGCC
GCAACGTGTTGTTCTTCATGACCTCGAATCTCGGTTACGAGGCCGTGGTGCGCCATGCCGACGACCACGA
GGCCATGGATGCGGCGCTCTATCCAGTGCTGGCCGACTTCTTCAAGCCGGCGCTGCTGGCGCGCATGGAG
GTAGTGCCCTACCTGCCGCTGTCGCGGGACATTCTCCACGATATCGTCTCCGCCAAGCTCGAGACCCTGG
CCGGGCGCATTCGCGACCGCCATCGCCAGGCCGAGGTGGTGCTGGAGCCGACGCTGGCCGAGGCCATCTG
TGCCCGGGCCACGCGCAGCGAGAATGGGGCCCGGATGCTCGAATCGATAATCGACGGTGAGCTGTTGCCG
CCGGTGTCGCGGGCGCTGCTCGAGTGCATGGCACGCCAGGAGCCGGTGGCCCGGGTTGCGCTCGGCGTGG
ATGAGCACGGCTTCACCGCGGAGGTCGGGTGA