SecReT6
Protein ID: 307545506
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2916
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2241395..2242729 [-]
Producthypothetical protein
NoteTssK
UniProt IDE1V3X1
KEGG IDhel:HELO_2916
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-162, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|307545506|ref|YP_003897985.1| unnamed protein product [Halomonas elongata DSM 2581]
MASRNPVVWSEGLFIKPQHFQQQQRSLEGLIDTRLRGVGGHLHGFLTLTLNTEYLSFGRIALSQASGVLP
DGTPFRLPDDDLEPPALEIADASVANQVVYLGVPLATDGVAEVSWETSSLPSRYRAETRGVRDLHSRAGD
LADLDLARVAPRLLLEQEDRSAYACLAVARILERRPDGSLVLDEAFLPTLLNVQAAPVLQRFVGEMAGLM
RERARNLAQRLATPNQSGVADVADFMLLQSLNRAQPRFQHLARLGHLHPERLYADMLEVCCELTTFTAES
RLPPEFPAYDHDRPEAAFRPLMQSLRQSLSTVLEPRAMAIQLQSRRFGLKVATLADHSLLDDADFILAVR
ADLPPERLRKLFVQQTKVASVERIRDLISLQLPGIPLEPLPVAPRQLPFHAGYTYFRLDRQSEAWSMLRG
ASGFAFHVAGDFPGLEMQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2242729-2241395 Halomonas elongata DSM 2581 chromosome, complete genome
ATGGCCAGTCGCAATCCCGTGGTCTGGAGTGAAGGGCTGTTCATCAAGCCCCAGCACTTCCAGCAGCAGC
AGCGCAGTCTGGAAGGGCTGATCGACACCCGTCTGCGCGGCGTCGGTGGCCACCTGCACGGTTTCCTGAC
CCTGACGCTCAATACCGAGTATCTGAGCTTCGGGCGCATCGCTCTCAGCCAGGCCAGTGGCGTGCTCCCC
GATGGCACTCCCTTCCGTCTGCCCGACGACGACCTGGAGCCCCCGGCGCTGGAGATCGCCGATGCCTCGG
TGGCCAATCAGGTGGTCTACCTGGGCGTGCCGCTGGCAACCGATGGTGTGGCCGAAGTGAGCTGGGAGAC
CTCGTCGCTGCCGTCTCGCTACCGTGCCGAAACGCGTGGCGTGCGCGACCTGCACTCTCGGGCCGGCGAC
CTGGCCGATCTCGACCTGGCGCGTGTCGCCCCGCGGCTGCTGCTCGAGCAGGAAGACCGCAGCGCCTACG
CCTGTCTGGCGGTGGCACGGATCCTCGAGCGACGTCCGGATGGCAGCCTGGTGCTCGACGAGGCGTTCCT
GCCGACCCTGCTCAATGTCCAGGCGGCGCCGGTGTTGCAGCGTTTCGTCGGCGAAATGGCCGGCTTGATG
CGCGAACGGGCCCGCAATCTGGCCCAGCGGTTGGCCACTCCCAATCAATCCGGAGTCGCCGACGTCGCCG
ACTTCATGCTGCTGCAGTCGCTCAACCGTGCCCAGCCGCGTTTTCAGCACCTGGCACGACTCGGTCACCT
GCATCCCGAGCGGCTCTACGCCGACATGCTCGAGGTTTGTTGCGAACTGACCACCTTCACCGCCGAGTCA
CGGCTGCCTCCGGAATTTCCGGCCTATGACCATGACCGGCCGGAGGCCGCTTTCCGGCCGCTGATGCAGA
GCCTGCGCCAGTCGCTGTCCACCGTGCTCGAGCCGCGCGCCATGGCCATCCAGCTGCAGTCGCGCCGCTT
CGGGCTCAAGGTTGCCACCCTGGCCGATCACAGCCTGCTCGACGATGCCGACTTCATCCTGGCAGTGCGT
GCGGACCTGCCGCCGGAACGCTTGCGCAAGCTGTTCGTGCAGCAGACCAAGGTGGCCAGCGTCGAGCGTA
TTCGCGACCTCATCAGCCTGCAGTTGCCGGGCATCCCGCTCGAGCCTCTGCCGGTGGCGCCGCGCCAGTT
GCCGTTCCATGCCGGTTACACCTACTTCCGTCTCGACCGCCAGAGCGAGGCCTGGAGCATGCTGCGCGGC
GCCAGCGGCTTCGCCTTCCACGTTGCCGGTGACTTCCCGGGACTGGAAATGCAGTTCTGGGCGATCAGGA
GCTAA