SecReT6
Protein ID: 307545507
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2917
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2242729..2243283 [-]
Producthypothetical protein
NoteTssJ
UniProt IDE1V3X2
KEGG IDhel:HELO_2917
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.90E-40, Aligned region: 21..175
Protein Sequence: 184 a.a.     [Download]
>gi|307545507|ref|YP_003897986.1| unnamed protein product [Halomonas elongata DSM 2581]
MIPRRAGAASLMRCLALGSMLLALAGCASTFEATGKTFQVLKDPSIPVGYPEDRPSRVDLSMLAAPSMNP
NAQGEGTPLRFQILQLKDDSMLMSADHRQLQEDLEEALGTNYLTHDDFTLLPGQFKFYEPFEVEEDTRYI
GIIAFYSNPNQAQWKKVVDIDDRGRDYHLLVHLLKREAALRKET
 
Nucleotide Sequence: 555 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2243283-2242729 Halomonas elongata DSM 2581 chromosome, complete genome
ATGATCCCCCGGCGGGCCGGGGCCGCGTCGCTGATGCGGTGCCTGGCACTCGGCAGCATGCTCCTGGCGC
TGGCTGGATGTGCCTCCACTTTCGAGGCCACCGGCAAGACTTTCCAGGTACTGAAGGACCCTTCGATCCC
GGTGGGATATCCGGAGGATCGTCCGTCACGGGTCGATCTGAGCATGCTGGCCGCGCCCAGCATGAACCCC
AACGCCCAAGGCGAGGGTACGCCTCTGCGCTTCCAGATCCTGCAGCTCAAGGACGACTCGATGCTGATGT
CGGCCGATCATCGCCAGTTGCAGGAGGACCTCGAAGAGGCGCTCGGCACCAACTACCTGACCCATGACGA
CTTCACTCTGCTGCCCGGCCAGTTCAAGTTCTACGAACCGTTCGAGGTAGAAGAGGACACCCGCTACATC
GGCATCATCGCCTTCTACTCCAACCCCAACCAGGCGCAGTGGAAGAAGGTGGTGGATATCGATGATCGCG
GACGCGACTACCACCTGCTGGTACATCTGCTGAAGCGCGAGGCCGCGCTGAGGAAGGAAACCTGA