SecReT6
Protein ID: 307545508
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2918
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2243280..2244602 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDE1V3X3
KEGG IDhel:HELO_2918
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.90E-07, Aligned region: 37..104
Protein Sequence: 440 a.a.     [Download]
>gi|307545508|ref|YP_003897987.1| unnamed protein product [Halomonas elongata DSM 2581]
MNETFPQQQAITLVVTNSERLEGRSTSSHVFPAEGGTLGSGSSDDWLLQDHANRVRPGHAEIQRLDGRFC
LIDRCGQTFVNRATLPIGRERRVALRDGDELQVGEYWLRVHMGDRQAAVAGVQPLATLVDEEHETLEGAE
PVSATAVVTRPQHDPLEALGEVSSAQRHQDPMAALADETIAGEDDHHELLDALDGQGATAGAPAAPRQRG
YEDPDMNEHLLNDLERSVGEQLEERWQDEPTGEVGHVGASPLLQTLGGELRFRDSAEQHAFLEEAGRTLK
ATVEGLLALHQAHDGSRYPLRDRRLQPIEDNPLRLGQPYEQTLTTLFAAQRSPVHLSAPAAVTECLEHQQ
QHQAAVEEAIGTALKSILDAFSPDALLKRFHAYRGAGRQGDDEGGWAWEMYRHYYQELNSGRQQGFEKLF
WEVFEQAYDQSVRRQQREDA
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2244602-2243280 Halomonas elongata DSM 2581 chromosome, complete genome
ATGAACGAGACGTTTCCCCAGCAGCAGGCCATCACTCTGGTGGTCACCAACAGTGAACGGCTCGAGGGCC
GCTCGACCAGCAGCCACGTCTTTCCGGCCGAGGGCGGAACCCTGGGCAGCGGATCGTCCGACGACTGGCT
GCTGCAGGATCACGCCAACCGGGTACGCCCCGGCCATGCCGAGATCCAGCGCCTGGACGGTCGTTTCTGC
CTGATCGACCGCTGTGGCCAGACCTTCGTCAACCGCGCGACTCTGCCGATCGGTCGCGAGCGCCGTGTGG
CGCTGCGCGACGGTGATGAGTTGCAGGTAGGGGAATACTGGCTGCGGGTGCACATGGGCGACCGTCAGGC
CGCTGTCGCCGGTGTGCAGCCACTGGCAACCCTGGTCGACGAGGAACACGAGACGCTGGAGGGCGCCGAG
CCGGTGTCGGCCACCGCCGTCGTGACGCGGCCCCAGCATGACCCGCTGGAGGCACTGGGCGAGGTTTCAT
CGGCGCAACGTCATCAGGATCCCATGGCCGCGCTGGCCGACGAGACCATCGCCGGCGAGGACGATCATCA
CGAACTGCTCGATGCCCTGGACGGGCAGGGCGCTACCGCTGGTGCGCCGGCCGCACCAAGGCAACGAGGT
TACGAGGACCCCGACATGAATGAACACCTGCTGAACGATCTGGAACGCTCGGTCGGCGAGCAACTCGAAG
AGCGCTGGCAAGACGAGCCAACAGGAGAGGTCGGCCACGTCGGCGCCTCACCGTTGCTGCAGACCCTGGG
CGGCGAGTTGCGCTTCCGTGACAGTGCCGAGCAGCACGCCTTTCTCGAAGAGGCGGGGCGCACCCTCAAG
GCCACCGTGGAAGGCCTGCTGGCACTGCACCAGGCCCACGACGGTAGCCGTTATCCGCTGCGCGACCGTC
GCCTGCAGCCCATCGAGGACAACCCGCTGCGCCTGGGGCAACCCTATGAGCAGACACTGACGACACTGTT
TGCGGCCCAGCGCAGCCCGGTGCATCTCTCGGCGCCGGCGGCGGTGACCGAATGCCTCGAACACCAGCAA
CAGCACCAGGCCGCGGTGGAGGAAGCCATCGGGACGGCGCTCAAGTCGATTCTCGATGCCTTCTCGCCGG
ATGCCTTGCTCAAGCGCTTTCATGCCTATCGCGGTGCAGGTCGCCAGGGTGATGACGAAGGCGGCTGGGC
CTGGGAGATGTATCGCCACTACTACCAGGAGCTCAACTCGGGTCGGCAGCAGGGCTTCGAGAAGCTGTTC
TGGGAAGTCTTCGAACAGGCCTACGACCAGTCGGTGCGTCGCCAGCAGCGGGAGGACGCATGA