SecReT6
Protein ID: 307545509
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2919
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2244607..2245626 [-]
Producthypothetical protein
NoteTssG
UniProt IDE1V3X4
KEGG IDhel:HELO_2919
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.80E-94, Aligned region: 21..321
Protein Sequence: 339 a.a.     [Download]
>gi|307545509|ref|YP_003897988.1| unnamed protein product [Halomonas elongata DSM 2581]
MDLAVRPAAPDVALAPLVDGARRYDFYQLVELLHRHYGDDLEGDREADPAAERVRFEASASLGFPGSDII
ALEPQDAERYTMRVSFLGLQGAQSPLPGYYLEAMAHAEAHREGAAGDFLNLFNHRVLSLLHRGWRKYRHH
VRYQDGAEDGFSAAIFSLVGLADERLRGETPINWSKMLAYAGLLAGRSRSPDVVAGIVGHCFDLDGVEIE
PWVHRRVEIPSDQRTRSGLSGSTLGQDMVAGGWVDDISGKFALRMRGLDLTRFRDFLPDGRDHQALLTLM
EFVLREPLAYDLELELLERDVKPMRLGEGGSCQLGWTTFVKPEAGTAAQRRRVRIQMTR
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2245626-2244607 Halomonas elongata DSM 2581 chromosome, complete genome
ATGGACCTTGCAGTCAGGCCAGCAGCCCCTGATGTAGCGCTCGCCCCCCTGGTCGACGGGGCCCGGCGCT
ACGACTTCTATCAACTGGTGGAATTGCTTCACCGGCACTACGGCGACGATCTGGAAGGAGATCGGGAGGC
CGATCCTGCCGCCGAGCGAGTGCGTTTCGAGGCGTCGGCCTCGTTGGGCTTTCCGGGCAGCGACATTATC
GCCCTGGAGCCCCAGGATGCCGAGCGTTACACCATGCGCGTCAGTTTCCTGGGGCTCCAGGGGGCCCAGT
CGCCATTGCCGGGTTACTACCTGGAGGCCATGGCCCATGCCGAGGCGCATCGCGAAGGCGCGGCCGGGGA
CTTCCTGAATCTCTTCAACCACCGGGTGCTATCGCTTCTGCATCGCGGCTGGCGCAAGTATCGCCACCAT
GTGCGTTACCAGGACGGGGCCGAGGACGGTTTCTCGGCGGCAATCTTCTCCCTGGTCGGGTTGGCCGATG
AGCGGTTGCGCGGCGAGACGCCGATCAACTGGAGCAAGATGCTGGCCTATGCCGGTCTGCTGGCTGGCCG
TTCGCGCTCGCCGGATGTGGTAGCGGGCATCGTCGGCCACTGCTTCGATCTCGACGGCGTCGAGATCGAG
CCCTGGGTGCACCGGCGGGTCGAGATTCCATCGGACCAGCGCACTCGTAGCGGCCTGAGCGGTTCCACAT
TGGGCCAGGATATGGTCGCCGGCGGCTGGGTCGACGATATCAGCGGCAAGTTCGCACTTCGTATGCGCGG
CCTGGACTTGACCCGTTTCCGCGATTTCCTGCCCGACGGTCGCGACCATCAGGCGCTGCTTACCCTGATG
GAATTCGTGCTGCGTGAGCCTCTGGCCTATGACCTGGAACTCGAGCTCCTGGAGCGCGACGTGAAGCCCA
TGCGCCTGGGCGAAGGAGGCAGTTGCCAACTGGGCTGGACGACCTTCGTCAAGCCCGAGGCAGGCACGGC
GGCCCAGCGACGCCGGGTGCGCATTCAGATGACACGGTGA