SecReT6
Protein ID: 307545510
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2920
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2245590..2247353 [-]
Producthypothetical protein
NoteTssF
UniProt IDE1V3X5
KEGG IDhel:HELO_2920
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-205, Aligned region: 2..587
Protein Sequence: 587 a.a.     [Download]
>gi|307545510|ref|YP_003897989.1| unnamed protein product [Halomonas elongata DSM 2581]
MLNRYYRDELDFLKRQGREFAEGNPGLSRFLSEQSTDPDVERLLEGFAFLSGRLREKVDDEFPELTHSLI
GMLWPNYLRPVPSMTVMQFTPHWHGLSGAQTVPRGTSLASREVEGTACSFRTCHELTLYPLAHDGVTAHH
SREASVVELDLAVHSDQPLDALGVGDLRLHLGGNGYTARTLYLWMSHYLAGIELEVDGLRLPLPTHLLAP
VGFAAEDALLPYPRNVYQGYRILQEYLCFPEAFQFFDLQRLGDYLPARLAERMTLRFTFSRTLPADARVG
DDSLALYCTPAINLFAHDADPVDLSGERSEYRIRPSSRFPSHYEVFSVDDVEGWLESESGRIRGEPRRYV
PFESFEHQIERDRGREARYYRVRVRDSLRGDGFDHDIAFVRGDEQACLGLRETISLRLTCSNRELPERLT
VGDICVPTEDSPAFAEFRNIIRPTPTMRPTLDGSLLWTLISNLSLNYLSLLDRDALRSVLRVYDFRALVD
RQAERIAQKRLAGIIDIKTEPVDRLYRGLPVRGLRSEMTLDQEAFGDEGSLFLFASVLSRFFSLYASINS
FHELHVTNLHNRERYAWTLQSGQQPLM
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2247353-2245590 Halomonas elongata DSM 2581 chromosome, complete genome
ATGCTGAACCGCTACTACCGGGACGAACTGGACTTTCTGAAGCGTCAGGGGCGGGAGTTTGCCGAGGGCA
ATCCCGGACTCAGCCGTTTTCTGTCCGAGCAGAGCACCGATCCCGATGTCGAGCGCCTGCTCGAGGGCTT
CGCCTTCCTGTCGGGCCGGTTGCGGGAGAAGGTCGATGACGAGTTCCCCGAGCTGACTCACTCGTTGATC
GGCATGTTGTGGCCCAACTACCTGCGGCCGGTGCCGAGCATGACGGTGATGCAATTCACCCCGCACTGGC
ACGGGCTGAGCGGCGCCCAGACCGTACCTCGTGGTACCAGCCTGGCCAGCCGCGAGGTCGAGGGTACGGC
TTGCAGTTTTCGTACCTGCCACGAGCTGACGCTCTACCCACTGGCCCACGATGGGGTCACGGCGCACCAT
TCCCGTGAGGCCTCGGTGGTCGAGCTGGATCTGGCGGTGCACAGCGATCAGCCCCTCGATGCCCTGGGCG
TGGGCGACCTGCGCCTGCACCTGGGCGGCAATGGCTACACGGCCCGTACCCTTTATCTGTGGATGAGCCA
CTACCTGGCCGGTATCGAACTGGAAGTCGACGGCCTGCGCCTGCCGCTGCCCACGCACCTGTTGGCGCCG
GTGGGCTTCGCTGCCGAGGATGCGCTGCTGCCGTATCCGCGCAACGTCTACCAGGGCTATCGCATCCTGC
AGGAATACCTGTGCTTCCCCGAGGCCTTCCAGTTCTTCGACCTGCAGCGCCTGGGCGATTACCTGCCGGC
GCGTCTGGCCGAGCGGATGACGTTGCGCTTCACCTTCTCGCGTACCCTGCCGGCGGATGCCCGGGTAGGG
GACGACAGCCTGGCGCTGTACTGCACGCCGGCGATCAACCTCTTCGCCCATGACGCCGACCCGGTGGACC
TCAGTGGCGAGCGCAGCGAATATCGTATCCGTCCCAGCAGCCGCTTCCCGTCGCATTACGAGGTGTTCAG
CGTCGATGATGTGGAGGGATGGCTGGAGAGCGAGAGTGGGCGCATCCGCGGAGAGCCTCGCCGATACGTG
CCTTTCGAGAGTTTCGAGCACCAGATCGAGCGCGATCGGGGGCGTGAAGCGCGCTACTACCGGGTGCGTG
TGCGCGACAGCCTGCGTGGCGACGGTTTCGACCACGACATCGCCTTCGTGCGTGGCGACGAGCAGGCTTG
TCTGGGGCTGCGCGAGACCATCTCGCTGCGCCTGACCTGCAGCAATCGCGAACTGCCCGAGCGGCTGACG
GTCGGCGATATCTGCGTGCCCACCGAGGATAGTCCGGCCTTTGCCGAGTTTCGCAATATCATCCGGCCGA
CCCCGACCATGCGACCGACCCTGGACGGCAGTCTGCTGTGGACGCTGATTTCCAATCTGTCGCTGAATTA
CCTGTCATTGCTCGACCGCGACGCCCTGCGGTCGGTGCTGCGGGTCTACGACTTCCGGGCGCTGGTCGAC
CGCCAGGCCGAGCGCATCGCCCAGAAGCGCCTGGCCGGCATCATCGATATCAAGACCGAGCCGGTGGACC
GGCTTTACCGTGGCCTGCCAGTACGCGGGCTGCGCTCCGAGATGACCCTGGATCAGGAAGCCTTCGGCGA
CGAGGGGAGTCTCTTCCTGTTCGCCAGCGTGCTGTCCCGGTTCTTCTCGCTGTACGCCAGCATCAACTCC
TTCCACGAGTTGCACGTCACCAACCTTCACAACCGCGAGCGCTACGCATGGACCTTGCAGTCAGGCCAGC
AGCCCCTGATGTAG