SecReT6
Protein ID: 307545511
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2921
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2247361..2247795 [-]
Producthypothetical protein
NoteTssE
UniProt IDE1V3X6
KEGG IDhel:HELO_2921
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-20, Aligned region: 36..123
Protein Sequence: 144 a.a.     [Download]
>gi|307545511|ref|YP_003897990.1| unnamed protein product [Halomonas elongata DSM 2581]
MTAFRDRSGLLGARLFERLSSPARPAPEGDEAVEATLASIKRHLVDLLNSHPGHSECAPELGLLDFNDAT
LGVLDLELKVERAIRECIERFEPRVSRVQVETLPNEGTPLQLRFQVQATLDLGHDSTQTTIDLLLNDKRY
QCLN
 
Nucleotide Sequence: 435 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2247795-2247361 Halomonas elongata DSM 2581 chromosome, complete genome
ATGACCGCTTTCAGGGATCGAAGCGGACTGCTCGGTGCTCGGTTGTTCGAGCGCCTGTCGTCGCCGGCGC
GTCCGGCACCGGAGGGCGACGAAGCAGTCGAGGCCACCCTGGCCTCCATCAAGCGACACCTGGTCGACCT
GCTCAACAGCCATCCGGGGCACAGCGAATGTGCCCCGGAGCTGGGTCTGCTCGACTTCAATGACGCCACG
CTCGGTGTGCTTGACCTCGAACTCAAGGTCGAGCGTGCCATACGCGAGTGCATCGAGCGCTTCGAGCCGC
GGGTGAGTCGCGTTCAGGTCGAGACACTGCCCAACGAGGGTACCCCGTTGCAGTTGCGCTTCCAGGTCCA
GGCCACTCTGGACCTGGGGCATGATTCGACCCAGACCACCATCGACCTGCTGCTCAACGACAAGCGCTAC
CAGTGCCTGAACTGA