SecReT6
Protein ID: 307545512
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2922
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2247800..2249287 [-]
Producthypothetical protein
NoteTssC
UniProt IDE1V3X7
KEGG IDhel:HELO_2922
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.50E-190, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|307545512|ref|YP_003897991.1| unnamed protein product [Halomonas elongata DSM 2581]
MTESTQSQAQSQATESTEDVSLLDQVMAKTRMAPADEGYDVAKQGVAAFISELLKSDDGQQQVNKSVVDR
MIVELDRKIGHQVDEILHDQEFQHLESAWRGLKLLVDRTDFRENIKLNVLHATKEELLEDFEFASEISQS
GLYQHVYAAEYGQFGGEPVAAMIGHYDFTPSGPDIKLLQYAASVGAMSHAPFLSSVAPSFFGIDSFEELP
NIKDFKAIFEGPKYARWRNLRESEDARYLGLTAPRFLLRTPYDPVENPVKSFHYQESVSESHDDYLWGNT
AYLLAERLNDSFAKYRWCPNIIGPQSGGAVENLPMHTYEALGQVQNKIPTEVLITDRREFEMAEEGFISL
TMRKGSDNAAFFSANSVQKPKSFPNTPEGREAETNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKERQ
DLERELNTWIRQYVADQENPPADVRSRRPLRAASVQVSDVEGDPGWYQVSLAVRPHFKYMGANFELSLVG
RLDKD
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2249287-2247800 Halomonas elongata DSM 2581 chromosome, complete genome
ATGACCGAATCTACCCAATCCCAGGCTCAGAGCCAGGCTACCGAGAGCACCGAAGACGTCTCCCTGCTTG
ATCAGGTGATGGCCAAGACACGTATGGCTCCTGCTGATGAAGGCTACGACGTGGCCAAGCAGGGGGTCGC
AGCTTTCATCAGTGAGCTGCTCAAGAGCGATGACGGTCAGCAGCAGGTCAACAAGTCGGTCGTCGATCGC
ATGATCGTCGAGCTGGATCGCAAGATCGGTCACCAAGTCGACGAGATTCTCCACGATCAGGAGTTCCAGC
ATCTGGAATCGGCCTGGCGTGGCCTCAAGTTGTTGGTCGATCGCACCGATTTCCGCGAGAACATCAAGCT
CAACGTGCTGCATGCCACCAAGGAGGAGTTGCTCGAGGACTTCGAGTTCGCCTCCGAGATCAGCCAGAGC
GGGCTCTATCAGCATGTCTATGCCGCCGAGTATGGCCAGTTCGGCGGCGAGCCGGTGGCGGCGATGATCG
GGCATTACGATTTCACGCCCTCGGGCCCGGACATCAAGTTGCTGCAGTATGCTGCCTCGGTCGGGGCGAT
GTCCCACGCACCCTTCCTGTCCTCGGTGGCGCCGAGCTTCTTCGGCATCGACAGCTTCGAGGAGCTGCCC
AACATCAAGGACTTCAAGGCGATCTTCGAAGGGCCGAAATACGCCCGCTGGCGCAATCTGCGCGAGTCCG
AGGATGCTCGCTACCTGGGGCTGACGGCGCCGCGCTTCCTGCTGCGCACGCCCTACGATCCGGTAGAGAA
TCCGGTCAAGTCCTTCCATTACCAGGAGTCGGTCAGCGAGAGCCACGACGATTACCTGTGGGGCAATACC
GCCTACCTGCTCGCAGAGCGCCTGAACGACAGCTTTGCCAAGTATCGTTGGTGCCCGAACATCATTGGTC
CGCAGAGCGGCGGGGCAGTGGAGAATCTGCCGATGCACACCTATGAAGCGTTGGGTCAGGTGCAGAACAA
GATTCCCACCGAGGTGTTGATTACCGACCGTCGCGAGTTCGAGATGGCCGAGGAAGGTTTCATCTCGCTG
ACCATGCGCAAGGGCAGTGACAACGCCGCCTTCTTTTCCGCCAACTCGGTGCAGAAGCCCAAGTCCTTCC
CCAACACGCCCGAAGGGCGCGAGGCCGAGACCAACTACAAGCTCGGCACCCAGTTGCCTTATCTGTTCAT
CGTCAATCGCCTGGCTCACTACATCAAGGTGCTGCAGCGCGAACAGATAGGCTCCTGGAAGGAGCGCCAG
GATCTCGAGCGTGAACTCAACACCTGGATCCGCCAGTACGTCGCAGATCAGGAGAATCCGCCCGCCGATG
TGCGTAGCCGACGCCCGCTGCGTGCCGCCTCGGTGCAGGTCTCCGACGTGGAAGGCGATCCGGGCTGGTA
CCAGGTGTCGCTGGCAGTACGCCCGCATTTCAAGTACATGGGTGCCAACTTCGAACTGTCGCTGGTGGGC
CGTCTCGACAAGGATTGA