SecReT6
Protein ID: 307545513
SecReT6 ID410
T6SS typei1
Gene symbol-
Locus tagHELO_2923
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2249318..2249836 [-]
Producthypothetical protein
NoteTssB
UniProt IDE1V3X8
KEGG IDhel:HELO_2923
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-55, Aligned region: 5..161
Protein Sequence: 172 a.a.     [Download]
>gi|307545513|ref|YP_003897992.1| unnamed protein product [Halomonas elongata DSM 2581]
MSKEGSVAPKERINIKYVPATGDKQADTELPQKLLVVGDFKGGVEETPIEEREAVSVNKDNFQSVMREAG
LGLRTSVPNRLEEGDEDEARELGVDLQFNSLQDFAPDSVARQVPELRKLVELREALVALKGPLGNVPAFR
ERLQALIESPETRDQLLNELELLDSESPSSDS
 
Nucleotide Sequence: 519 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2249836-2249318 Halomonas elongata DSM 2581 chromosome, complete genome
ATGTCCAAGGAAGGGTCCGTTGCGCCCAAAGAGCGCATCAATATCAAGTACGTTCCCGCCACCGGAGATA
AGCAGGCCGACACCGAACTGCCCCAGAAGCTTCTGGTGGTCGGTGATTTCAAGGGCGGCGTCGAAGAGAC
TCCCATCGAGGAGCGCGAAGCCGTCTCGGTGAACAAGGACAACTTCCAGTCCGTGATGCGCGAGGCTGGT
CTCGGGCTGCGGACCAGCGTGCCGAACCGTCTCGAGGAAGGTGATGAAGATGAGGCCCGCGAACTGGGGG
TCGATCTGCAGTTCAACTCTCTGCAGGACTTCGCGCCAGACAGCGTGGCGCGCCAGGTGCCTGAGCTGCG
CAAGCTGGTCGAGCTGCGCGAGGCGCTGGTGGCTCTCAAGGGGCCCCTCGGCAACGTGCCGGCCTTCCGG
GAACGCCTGCAGGCCTTGATTGAGAGTCCCGAGACCCGGGACCAGCTGTTGAACGAGCTCGAACTTCTCG
ACAGCGAATCCCCCTCGAGCGATTCCTGA