SecReT6
Protein ID: 307728581
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0511
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]570222..573008 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE1T8C3
KEGG IDbgf:BC1003_0511
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.80E-40, Aligned region: 248..283
AAA_2 [PF07724], Evalue: 8.80E-40, Aligned region: 631..815
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 250..362
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 636..742
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 250..269
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 635..739
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 821..894
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 71..112
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 227..271
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 294..328
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 535..548
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 605..678
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 700..729
AAA_16 [PF13191], Evalue: 3.20E-12, Aligned region: 798..867
AAA_22 [PF13401], Evalue: 8.30E-10, Aligned region: 249..335
AAA_22 [PF13401], Evalue: 8.30E-10, Aligned region: 634..654
AAA_22 [PF13401], Evalue: 8.30E-10, Aligned region: 697..729
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 250..278
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 635..656
Arch_ATPase [PF01637], Evalue: 2.30E-06, Aligned region: 228..264
Arch_ATPase [PF01637], Evalue: 2.30E-06, Aligned region: 302..402
Arch_ATPase [PF01637], Evalue: 2.30E-06, Aligned region: 634..677
Arch_ATPase [PF01637], Evalue: 2.30E-06, Aligned region: 706..729
IstB_IS21 [PF01695], Evalue: 7.80E-06, Aligned region: 244..275
IstB_IS21 [PF01695], Evalue: 7.80E-06, Aligned region: 635..653
Sigma54_activat [PF00158], Evalue: 1.10E-05, Aligned region: 245..265
Sigma54_activat [PF00158], Evalue: 1.10E-05, Aligned region: 634..752
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 250..271
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 621..675
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 250..292
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 494..515
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 634..670
AAA_17 [PF13207], Evalue: 3.80E-05, Aligned region: 837..923
AAA_18 [PF13238], Evalue: 5.40E-05, Aligned region: 250..270
AAA_18 [PF13238], Evalue: 5.40E-05, Aligned region: 636..665
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 247..270
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 633..653
AAA_14 [PF13173], Evalue: 0.00022, Aligned region: 250..332
AAA_14 [PF13173], Evalue: 0.00022, Aligned region: 634..725
AAA_29 [PF13555], Evalue: 0.00062, Aligned region: 244..266
AAA_29 [PF13555], Evalue: 0.00062, Aligned region: 633..660
RuvB_N [PF05496], Evalue: 0.0009, Aligned region: 249..267
RuvB_N [PF05496], Evalue: 0.0009, Aligned region: 310..330
RuvB_N [PF05496], Evalue: 0.0009, Aligned region: 602..656
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 250..274
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 303..337
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 375..404
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 538..559
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 633..654
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 24..66
Clp_N [PF02861], Evalue: 0.0011, Aligned region: 105..123
AAA_28 [PF13521], Evalue: 0.0019, Aligned region: 250..269
AAA_28 [PF13521], Evalue: 0.0019, Aligned region: 635..655
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 240..268
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 634..652
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 251..271
RNA_helicase [PF00910], Evalue: 0.0039, Aligned region: 636..655
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 250..267
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 634..654
AAA_33 [PF13671], Evalue: 0.0055, Aligned region: 806..858
Protein Sequence: 928 a.a.     [Download]
>gi|307728581|ref|YP_003905805.1| type VI secretion ATPase, ClpV1 family [Burkholderia sp. CCGE1003]
MTHRDLSPYLRRLNDHCARALADAASLCATRAHRDIEVEHWLIKLLELGDGDIVAIMRRYTLDVDGVWNG
LLSAIDRLPHDLRGKPGLSSRLGQLLEAAWLRASLEAQTPLIRSAHLLAALADMPQLLRAPDAWALLSLS
SVQIERLTPELNWTSVEAPASSPCTQEPDNVPNAHDTADSALPDEPDSDPFPAVARAGGLAKPVSEALDR
FTIDVTQKAREGAIDPVFGRDVEIRQMIDILARRRKNNPILIGEPGVGKTALVEGLALKIAEGDVPAAIR
DVRLLTLDLGLLQAGAGVKGEFEQRLKNVIAAVQQSPTPILLFIDEAHTLIGAGNSAGGGDAANLLKPAL
ARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDENACLMLRGLKERYARHHGVHITDAAVSAA
VRLSRRYLSGRQLPDKAVDLIDTAAARVRMSMDATPVAIAARHAELAALRVEREALIEDQGATSVDLGER
LRGIDARLSALAHEVEELDADYAGQKAAITSLTELRTKWRDAPDDSARHDLEPAIRAAHARLARDANGAL
IHAEVDEAVIARVIADWTGVPVGSLLEDELTTLLELETRLAGSVVGQQDALAALGKTLRAAKAGLKSDEA
PLGVFLLVGPSGVGKTETARALADLMFGGERALITINLSEYQEAHTVSQLKGSPPGYVGYGRGGVLTEAV
RQRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFMRDGEGRVIDFRNTVIGMTSNLGSEQIMAAVEAASESS
SEDAAADTNQAPAHHAEPTSAMLMETIRPLLVEHFQPALLARFQTVVYRPLTAEALAQIVQMKLDKVARR
IEKRFAVPLVCDHALIAELVRACLLPDSGARNIDSLLDQQILPVLSRELLERVASHELPSRIRLGYSDET
GISVDFDSDCAAEYEAAA
 
Nucleotide Sequence: 2787 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c573008-570222 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGACTCATCGCGACCTCTCTCCGTATCTGCGCCGCCTCAACGATCACTGCGCCCGCGCGCTCGCCGACG
CCGCGAGTCTGTGCGCGACGCGTGCCCATCGTGACATCGAAGTCGAACACTGGTTGATCAAGCTGCTCGA
ACTGGGCGACGGGGACATCGTCGCAATCATGCGCCGCTACACGCTCGACGTGGACGGAGTGTGGAACGGC
CTGCTAAGTGCAATCGACCGCCTGCCACACGACCTGCGCGGCAAGCCCGGCTTGTCGTCCCGGCTCGGGC
AACTGCTCGAAGCGGCCTGGCTGCGGGCGTCGCTCGAAGCGCAAACACCGCTGATCCGCTCCGCGCATCT
GCTGGCAGCGCTGGCGGACATGCCGCAATTGCTGCGTGCGCCGGACGCGTGGGCGCTGCTTTCGCTGTCG
TCCGTGCAGATCGAGCGCCTCACGCCCGAGCTCAACTGGACCTCCGTCGAAGCGCCGGCCAGCAGCCCCT
GCACGCAGGAGCCGGACAACGTACCAAACGCGCACGACACAGCGGACAGCGCGCTCCCCGATGAGCCCGA
CTCCGATCCCTTCCCCGCCGTCGCGCGCGCGGGCGGCCTCGCCAAGCCGGTGTCAGAGGCGCTCGACCGC
TTCACTATCGACGTCACGCAGAAAGCGCGCGAAGGCGCCATCGACCCCGTGTTCGGCCGCGACGTCGAAA
TCCGCCAGATGATCGACATCCTCGCGCGCCGGCGCAAGAACAACCCGATCCTGATCGGCGAGCCCGGGGT
GGGCAAGACGGCGCTCGTGGAGGGCCTGGCGCTGAAAATCGCCGAGGGCGACGTGCCCGCCGCGATCCGC
GACGTGCGCCTGCTCACGCTCGACCTCGGCCTGCTGCAAGCGGGCGCGGGCGTCAAAGGCGAGTTCGAGC
AGCGTCTGAAGAACGTGATCGCGGCGGTACAGCAATCGCCGACGCCGATATTGCTGTTCATCGACGAAGC
GCATACGTTGATCGGCGCCGGCAACTCGGCGGGCGGCGGCGACGCGGCCAATCTGCTGAAGCCGGCGCTC
GCACGCGGAGAGCTGCGCACGATTGCCGCGACCACCTGGTCCGAATATAAGCAGTACTTCGAGCGCGACG
CAGCGCTCGAACGCCGTTTCCAGATGGTGAAGGTCGACGAACCCGACGACGAGAACGCATGCCTGATGCT
ACGCGGCCTGAAGGAACGCTACGCGCGCCACCACGGCGTGCATATCACGGACGCCGCCGTCAGCGCGGCT
GTGCGTCTGTCGCGCCGCTATCTGAGCGGGCGGCAACTGCCCGACAAGGCTGTCGACCTGATCGACACCG
CGGCAGCCCGCGTGCGTATGAGCATGGACGCGACGCCGGTCGCAATTGCCGCGCGTCATGCAGAACTGGC
CGCGCTGCGCGTGGAGCGCGAGGCACTGATCGAGGACCAGGGCGCGACATCGGTGGATTTGGGCGAGCGG
CTTCGCGGCATCGACGCACGCCTCTCCGCCCTCGCCCATGAGGTCGAGGAACTGGACGCGGACTACGCCG
GACAGAAGGCTGCCATCACGTCGCTCACGGAGTTGCGCACAAAATGGCGCGACGCGCCCGACGACTCGGC
GCGGCACGACCTGGAGCCGGCTATCCGGGCGGCGCATGCGCGCCTCGCCCGCGACGCGAACGGCGCGCTG
ATTCATGCCGAGGTCGACGAGGCCGTGATAGCACGCGTCATTGCCGACTGGACCGGCGTGCCGGTCGGCA
GCCTGCTCGAAGACGAACTCACCACGCTGCTGGAACTGGAGACGCGACTCGCGGGCAGCGTCGTCGGCCA
GCAGGATGCGCTCGCCGCATTGGGCAAAACGCTGCGTGCCGCCAAGGCCGGCTTGAAGTCCGACGAAGCG
CCGCTCGGCGTATTTCTGCTCGTCGGCCCTTCGGGCGTAGGCAAGACAGAAACGGCACGGGCTTTGGCCG
ACCTGATGTTCGGCGGTGAACGCGCGCTGATTACGATCAACCTCTCCGAGTATCAGGAAGCGCACACGGT
CTCGCAACTGAAGGGCTCGCCGCCCGGTTACGTCGGCTATGGCCGGGGCGGCGTGCTGACAGAGGCGGTG
CGTCAACGGCCCTATAGCGTGGTGCTGCTCGACGAGGTGGAAAAGGCCCATCGCGACGTCCTGAATCTGT
TTTATCAGGTGTTCGACCGCGGGTTCATGCGCGACGGCGAAGGGCGCGTAATCGACTTTCGCAATACCGT
CATCGGGATGACGTCGAACCTGGGCAGCGAGCAGATCATGGCCGCCGTCGAGGCCGCGTCGGAAAGCTCG
AGCGAAGATGCGGCAGCCGACACGAACCAGGCACCGGCACACCATGCCGAACCGACCAGCGCCATGCTTA
TGGAAACCATTCGTCCGCTACTGGTCGAACATTTTCAGCCGGCATTGCTCGCGCGTTTTCAGACCGTCGT
GTACCGGCCTCTCACGGCTGAAGCGCTCGCGCAAATCGTGCAGATGAAACTCGACAAGGTCGCACGTCGC
ATCGAAAAGCGCTTTGCCGTACCGCTTGTCTGCGACCATGCGCTCATTGCGGAACTCGTGCGTGCGTGCC
TGTTGCCCGACTCCGGCGCGCGCAATATCGACAGCCTGCTCGATCAGCAGATTCTTCCAGTGCTTTCACG
CGAATTGCTCGAGCGCGTTGCAAGCCATGAGTTGCCGTCGCGAATCAGACTCGGCTATTCGGACGAAACA
GGCATTAGCGTCGACTTCGACAGCGACTGCGCTGCCGAGTACGAGGCAGCGGCATGA