SecReT6
Protein ID: 307728584
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0514
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]575669..576340 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDE1T8C6
KEGG IDbgf:BC1003_0514
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-40, Aligned region: 20..214
Protein Sequence: 223 a.a.     [Download]
>gi|307728584|ref|YP_003905808.1| DotU family type IV / VI secretion system protein [Burkholderia sp. CCGE1003]
MTYASTSRAATLPPSLLPVALRDTALTVALLAADPAPQSFSAFRDKCKQQVRRLREEMQSAGHPQGVIED
AAYAQCALLDETALSNLRGDDRDAWQRLPLQVDEFQSNDAGHELIARIERRLAEPQPVLPLLAIFCAVLD
LGFTGKFAFAGREARAALVKALSERLGRAQDTSSSIVIKAPGSTRWTERLTPLTWVVGACVVAAVVYVAL
DQWLNASVARIAH
 
Nucleotide Sequence: 672 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c576340-575669 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGACGTACGCATCGACAAGCCGCGCGGCCACGCTGCCGCCTTCGTTGTTACCCGTGGCGTTGCGCGACA
CGGCGCTGACAGTCGCATTGCTGGCTGCGGATCCCGCGCCGCAGTCGTTCAGCGCCTTTCGGGACAAATG
CAAGCAGCAGGTCCGCAGGCTGCGCGAGGAAATGCAATCCGCGGGGCATCCGCAAGGCGTAATCGAAGAC
GCCGCTTACGCCCAATGCGCGCTGCTCGACGAAACAGCGTTGAGCAATCTGCGGGGCGACGATCGTGACG
CCTGGCAGCGTCTGCCGCTGCAAGTCGACGAATTCCAAAGCAACGACGCGGGGCATGAACTGATTGCGCG
TATCGAGCGCCGTCTGGCCGAGCCGCAACCGGTGCTGCCGCTGCTGGCCATTTTCTGCGCGGTGCTGGAC
CTGGGGTTCACGGGCAAATTCGCATTCGCTGGCCGCGAGGCCCGCGCCGCGCTCGTCAAGGCGCTCAGCG
AACGGCTCGGCCGCGCTCAGGACACGTCAAGCTCCATCGTCATCAAAGCGCCCGGCTCGACGCGCTGGAC
CGAGCGGCTTACGCCGCTGACGTGGGTCGTCGGCGCGTGCGTCGTCGCCGCCGTCGTGTACGTCGCGCTG
GATCAATGGCTCAACGCCTCCGTCGCCCGGATAGCACATTGA