SecReT6
Protein ID: 307728585
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0515
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]576337..577683 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE1T8C7
KEGG IDbgf:BC1003_0515
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-134, Aligned region: 18..445
Protein Sequence: 448 a.a.     [Download]
>gi|307728585|ref|YP_003905809.1| type VI secretion protein [Burkholderia sp. CCGE1003]
MKITRPLWAQGIFMTPQHFQQQALWERYADERTARIGSPDPWGVSRVAFDTQALSIDRLQLASLGLRLPD
GTLFDTESADRLPSPRDLSEVPAHTEAVVVLAALPLVDPQGGNCVEAGEKPARPRRYTREFLQVADLNGE
GKEEISVERHALALLFDFEEPGGYVTCPIGRIVRNAQGRFEIDAAFVPPCLVLSASSQWTSRMNRLSEIL
SAKSASLAVRRRERSDQIADYAVADVSLFWLLHSVNSTWPDLARLCQAPDQHPERLYSVLARLAGSLLTF
STTETLRAIPPYAHGAPEPVFAELESLIRTLLDTVIPSRVVPIALERIRDTAWLGKINDERLVEGADYYL
SVRSALPAHALLEQLPRLCKAGAPDEVEQIVNSALSGIPLRTMSRLPAAIPVRIENQYFALDGAHPAFKR
MVDARACQFYVPASMPDVSLELYAVLPT
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c577683-576337 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGAAGATTACAAGACCGCTGTGGGCGCAGGGCATTTTCATGACGCCCCAGCATTTCCAGCAACAGGCGC
TGTGGGAGCGGTACGCCGACGAGCGCACGGCGCGCATCGGCAGTCCCGACCCTTGGGGAGTGAGCCGGGT
GGCTTTCGACACGCAGGCGTTGTCGATCGACCGTCTGCAACTGGCGTCGCTGGGTCTGCGTCTGCCCGAC
GGCACCCTGTTCGATACCGAATCCGCCGACCGACTGCCGTCGCCTCGTGATCTAAGCGAGGTGCCTGCGC
ACACCGAAGCGGTCGTCGTGCTTGCGGCCCTGCCGCTCGTCGACCCGCAGGGTGGAAACTGCGTCGAAGC
TGGTGAGAAGCCTGCGCGTCCGCGCCGCTACACGCGGGAGTTCCTGCAAGTCGCCGATCTCAACGGCGAG
GGCAAGGAGGAGATCAGCGTCGAGCGTCACGCGCTTGCGCTGCTGTTCGACTTCGAGGAGCCAGGCGGCT
ATGTGACGTGCCCCATCGGCAGGATCGTGCGCAATGCGCAAGGCCGTTTCGAGATTGACGCAGCATTCGT
CCCGCCGTGCCTCGTGCTGTCCGCGAGCAGCCAGTGGACGAGCCGCATGAACCGGTTATCCGAAATCCTG
AGTGCGAAAAGCGCAAGTCTCGCCGTGCGCCGGCGCGAGCGCTCCGACCAGATCGCCGACTATGCGGTCG
CCGACGTTTCGCTGTTCTGGCTGCTGCACAGCGTGAACAGTACGTGGCCTGATCTTGCACGCCTGTGCCA
GGCGCCGGATCAGCATCCCGAGCGCCTGTATAGCGTGCTGGCGCGACTGGCCGGCTCGCTGCTCACGTTC
TCCACTACCGAAACGCTAAGAGCGATTCCGCCGTATGCGCACGGCGCGCCGGAGCCGGTTTTTGCGGAAC
TGGAGTCGCTGATCCGAACGCTGCTCGATACGGTGATTCCGTCGCGCGTCGTGCCGATCGCCCTCGAACG
TATTCGTGACACGGCGTGGCTCGGCAAGATCAACGACGAGCGGCTCGTCGAAGGCGCGGACTACTACCTG
TCGGTCCGCTCTGCCCTGCCCGCGCACGCGCTGCTCGAACAGTTGCCGCGTTTGTGCAAGGCCGGCGCGC
CGGACGAGGTCGAGCAGATCGTCAACTCGGCGCTCTCCGGCATTCCGTTGCGCACCATGTCGCGGCTTCC
CGCCGCCATTCCTGTGCGCATCGAAAATCAATATTTCGCGCTCGACGGTGCCCATCCCGCGTTCAAACGT
ATGGTGGATGCGCGCGCGTGCCAGTTCTACGTCCCGGCCTCCATGCCCGATGTGTCGCTGGAACTTTACG
CGGTGCTGCCGACATGA