SecReT6
Protein ID: 307728586
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0516
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]577814..579367 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDE1T8C8
KEGG IDbgf:BC1003_0516
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-179, Aligned region: 93..513
Protein Sequence: 517 a.a.     [Download]
>gi|307728586|ref|YP_003905810.1| type VI secretion protein EvpB [Burkholderia sp. CCGE1003]
MAKNETALQDSAATTTDTVVLDAPGKSVYESLCEKINLTPVKQTRPFDSFQNADSLSESSLDERVAQAMS
VFLKMINESSQQVDRLDKSLLDFHIAHLDRQISRQLDAIMHNETFQQIESAWRGLKFLVDRTDFRKNVRI
EVLDVSKEQLRQDFEDTPEVIQSGLYLHTYIQEYDTPGGEPIGSIISNYEFDRSPQDIALLRNIAKVSAA
AHMPFIGSVSPKFFGKDSMEEVASIRDIGNYFDRAEYLKWKSFRESDDARYIGLTLPRFLARLPYGPDTT
PVRAFNYEEAVKGPDHTRYLWANASFAFAANMVRSFIKNGWCVQIRGPQAGGLVEDLPIHLYDLGTGNQA
KIPSEVLIPETREFEFSNLGFIPLSYYKNHDFACFFSAHSAQKPAVYDTKEATANSRVNARLPYIFLLSR
IAHYLKLIQRENIGTTKDRRLLELELNTWVKSLVTEMTDPGDDLQASHPLREAKVIVEDIEDNPGFFRVK
LFIVPHFQIEGMDINLSLVSQMPKAKN
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c579367-577814 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGGCAAAGAACGAAACGGCACTTCAGGATTCGGCTGCAACCACGACGGACACCGTCGTGCTGGACGCGC
CCGGCAAGAGCGTCTACGAATCCCTCTGCGAAAAGATCAACCTGACGCCGGTTAAGCAAACGCGTCCGTT
CGACTCGTTCCAGAATGCGGACTCGTTGTCGGAATCCTCGCTCGATGAGCGTGTCGCGCAGGCAATGAGC
GTGTTCCTGAAGATGATCAACGAATCGTCGCAACAGGTAGATCGTCTCGACAAGAGTCTGCTGGACTTCC
ACATCGCGCATCTGGACCGGCAGATCAGCCGTCAGCTCGACGCGATCATGCACAACGAAACGTTCCAGCA
GATCGAATCGGCGTGGCGCGGGCTGAAGTTCCTGGTCGATCGCACCGATTTCCGCAAGAACGTTCGCATC
GAAGTGCTGGACGTATCGAAGGAACAGTTGCGCCAGGACTTCGAGGACACGCCTGAAGTAATTCAGAGCG
GCCTGTACCTGCACACCTACATTCAGGAATACGACACGCCGGGTGGTGAGCCGATCGGCTCGATCATCTC
GAACTACGAGTTCGACCGCAGCCCGCAGGACATCGCGCTGCTGCGCAATATCGCGAAGGTGTCGGCAGCG
GCTCATATGCCGTTCATAGGCTCGGTGTCGCCGAAGTTCTTCGGCAAGGATTCAATGGAAGAGGTCGCAA
GCATTCGCGACATCGGCAATTACTTCGACCGCGCCGAGTACCTGAAGTGGAAGAGCTTCCGCGAATCGGA
CGACGCCCGCTACATCGGTCTTACGCTGCCGCGCTTCCTCGCGCGTTTGCCGTATGGCCCCGACACCACG
CCGGTGCGCGCGTTCAACTACGAGGAAGCCGTCAAGGGCCCTGACCACACGCGCTATTTGTGGGCCAACG
CGTCGTTCGCGTTTGCGGCCAACATGGTGAGAAGCTTCATCAAGAACGGCTGGTGCGTGCAGATTCGCGG
TCCGCAGGCAGGCGGTCTGGTTGAAGACCTGCCGATCCACCTGTACGACCTTGGCACCGGCAACCAGGCC
AAGATTCCGAGCGAAGTGCTGATTCCCGAAACGCGCGAGTTCGAGTTCTCCAATCTCGGTTTCATTCCGC
TGTCGTACTACAAGAATCACGACTTCGCGTGCTTCTTCTCGGCACACTCGGCGCAAAAGCCGGCGGTGTA
CGACACCAAAGAAGCCACGGCGAACAGCCGCGTCAATGCGCGTCTGCCGTATATCTTCCTGCTCTCGCGA
ATCGCGCACTATCTGAAGCTGATTCAGCGCGAGAACATCGGCACGACGAAAGATCGTCGTTTGCTCGAGC
TGGAACTGAACACGTGGGTCAAGTCCCTCGTCACTGAAATGACCGATCCGGGCGACGACTTGCAGGCATC
GCACCCGCTGCGCGAAGCAAAGGTCATTGTCGAGGACATCGAGGACAACCCGGGCTTCTTCCGCGTCAAG
CTTTTCATCGTGCCGCACTTCCAGATCGAAGGCATGGACATCAATCTCTCGCTGGTCTCGCAAATGCCAA
AAGCAAAGAACTAG