SecReT6
Protein ID: 307728587
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0517
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]579394..579903 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE1T8C9
KEGG IDbgf:BC1003_0517
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.80E-55, Aligned region: 6..159
Protein Sequence: 169 a.a.     [Download]
>gi|307728587|ref|YP_003905811.1| type VI secretion protein [Burkholderia sp. CCGE1003]
MANSFQNEVPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQDTRALAERARIDINKNNFNSVLADY
SPKAKIAVENTLAGDGSELPVSLEFKSMDDFRPDVVAGKVPELRALMAARNLLRDLKSNLLDNATFRREL
EKILKDPALSDRLRSDLQQIGESAPATQQ
 
Nucleotide Sequence: 510 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c579903-579394 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGGCAAACAGCTTCCAGAACGAAGTACCAAAAGCAAGAATCAATATCAAGCTTGACTTGCATACTGGGG
GCGCTCAGAAAAAGGTGGAGCTTCCGCTCAAGCTGCTGGTCATGGGCGACTACAGCAACGGCCAGGACAC
GCGCGCACTCGCGGAACGCGCCAGGATCGACATCAACAAGAACAACTTCAATTCGGTTCTTGCCGACTAC
AGCCCCAAGGCGAAGATCGCTGTCGAAAACACGCTGGCAGGCGACGGCTCGGAGCTGCCGGTGAGCCTCG
AATTCAAGTCGATGGACGACTTCAGACCGGATGTCGTCGCAGGCAAGGTGCCGGAGTTGCGCGCGCTGAT
GGCTGCTCGCAACCTGCTGCGCGACCTCAAATCCAACCTGCTCGACAACGCAACGTTTCGTCGCGAGCTC
GAGAAAATCCTCAAGGACCCGGCCCTGTCCGACCGCCTGCGCTCGGACCTGCAGCAAATCGGTGAATCCG
CACCGGCTACGCAACAGTAA