SecReT6
Protein ID: 307728589
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0519
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]580612..582213 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDE1T8D1
KEGG IDbgf:BC1003_0519
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.40E-18, Aligned region: 65..123
ImpA-rel_N [PF06812], Evalue: 9.40E-18, Aligned region: 158..180
ImpA-rel_N [PF06812], Evalue: 9.40E-18, Aligned region: 402..419
Protein Sequence: 533 a.a.     [Download]
>gi|307728589|ref|YP_003905813.1| type VI secretion-associated protein [Burkholderia sp. CCGE1003]
MLTNLLSALFGARTPSDLARSTQGQWDDWLRPISDSAPTGADPGYDDDFLAIKEEVARLSDIDDTLIVET
AERLLKHSAKDVRLAVYYVYGRMRRDGAEGVACGFELLSALIDRFGEALLPARAGTRKAALEWLAGSTFA
DRLERVQGLSDSLLERTLSALALIVERTAQWPEAARPELDALFRRFESRVETPQPAPSVGNDIPSSATPS
SATLAASTLAAPTEVASTRELLDRARQMAQFLRDQPHGYLAAYRLMRCVRWDTLTEVPPHEASGKTRLVA
PRAELRSHLKRLLLQKQWPELLDRVEAAFAEGANHFWLDLQYYAFSAQEQAGGEYAQVRDLVATDCALML
ERLPGLDQLLFSDGSPFADDATLEWIARYATVRDVERGEAVAPVSSSSAHTDWAETEAHASDLAAQQGLE
AAFAWLQGLPAQSGDHGERERFLRQLVMARVAERADRADTALHLLSTLERSAQRFELGAWEPSLAFEAKH
HLLRLLKVRMNRKDADKPALSARIELLTGELTAIDPARAVTLA
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|307728076|ref|NC_014539.1|:580612-582213 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGCTAACGAACCTTCTGAGCGCGCTATTCGGCGCGCGCACGCCGTCCGATCTTGCCCGTTCGACACAAG
GCCAATGGGACGACTGGCTGCGTCCCATCAGCGATAGCGCGCCCACCGGGGCCGACCCCGGTTACGACGA
CGACTTCCTCGCGATCAAGGAGGAAGTCGCCCGACTTTCTGATATCGACGACACGTTGATCGTCGAAACA
GCCGAGCGCCTGCTCAAGCACAGCGCGAAGGATGTGCGTCTCGCGGTCTATTACGTGTATGGACGTATGC
GTCGCGATGGCGCTGAAGGCGTGGCGTGCGGCTTCGAACTGCTGTCGGCGCTCATCGACCGTTTTGGCGA
AGCGCTACTGCCGGCCCGCGCCGGAACCCGCAAGGCCGCGCTGGAGTGGCTCGCGGGCAGCACATTCGCG
GACCGGCTGGAGCGTGTGCAGGGCCTGTCGGATTCGCTGCTGGAACGCACGCTCTCGGCGCTCGCGCTGA
TTGTCGAGCGCACCGCGCAATGGCCGGAAGCCGCGCGTCCGGAACTGGATGCACTGTTTCGCCGTTTCGA
AAGTCGCGTGGAAACGCCGCAGCCTGCGCCAAGCGTCGGCAATGACATTCCCTCAAGCGCAACGCCGTCG
TCCGCGACCCTCGCGGCGTCGACGCTGGCTGCTCCGACCGAAGTCGCTTCGACCCGCGAACTGCTCGACC
GCGCGCGCCAAATGGCGCAGTTTCTGCGCGACCAGCCGCACGGGTATCTGGCGGCTTACCGGCTGATGCG
CTGCGTGCGCTGGGACACGCTCACGGAAGTGCCGCCGCACGAGGCGAGCGGCAAGACTCGGCTGGTTGCG
CCGCGCGCCGAATTGCGCTCGCATCTCAAACGGCTGCTTTTGCAAAAACAATGGCCCGAACTACTGGATC
GAGTGGAAGCGGCGTTTGCCGAAGGCGCCAACCACTTCTGGCTGGATCTTCAGTATTACGCGTTCAGCGC
GCAGGAGCAGGCGGGCGGCGAATATGCGCAGGTTCGCGACCTGGTCGCCACCGACTGCGCACTGATGCTC
GAGCGCCTGCCTGGACTCGATCAATTGTTGTTTTCCGACGGTTCGCCGTTTGCCGACGACGCGACGCTCG
AATGGATCGCGCGCTACGCGACGGTGCGTGATGTCGAGCGTGGCGAGGCAGTCGCGCCTGTGAGCTCGTC
GTCGGCACACACGGATTGGGCGGAAACCGAGGCGCACGCGTCAGATCTTGCCGCCCAGCAGGGACTCGAG
GCGGCGTTTGCCTGGCTGCAAGGCTTGCCCGCGCAGAGCGGAGACCACGGCGAACGCGAACGCTTCCTGC
GCCAACTGGTAATGGCTCGGGTGGCCGAGCGCGCCGACCGTGCGGACACGGCGCTGCATCTGCTGTCGAC
GCTCGAGCGCAGCGCACAGCGTTTCGAACTTGGCGCGTGGGAGCCGTCTCTCGCTTTTGAAGCCAAGCAT
CATCTGCTGCGTTTGCTGAAAGTGAGAATGAACCGCAAGGACGCAGACAAGCCGGCGTTGAGCGCGCGCA
TCGAACTGCTGACGGGCGAGCTGACCGCGATCGATCCGGCGCGAGCCGTCACGCTGGCTTAA