SecReT6
Protein ID: 307728590
SecReT6 ID495
T6SS typei2
Gene symbol-
Locus tagBC1003_0520
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]582363..582974 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE1T8D2
KEGG IDbgf:BC1003_0520
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-39, Aligned region: 14..164
Protein Sequence: 203 a.a.     [Download]
>gi|307728590|ref|YP_003905814.1| type VI secretion lipoprotein [Burkholderia sp. CCGE1003]
MMQQLRTGAIVLTMLALGGCGVGQTVKDSTVDAAKWAFTTQVKTMNIDLTSRSSLNASGDGQSLSTVIRI
YQLKTPQTFQQLDYQQLQANDLEALKADLLATKDVVLRPDASASISEPMNGDAQYVGVVAFFRNAGSDAT
WKLVIPKKQWKKTDPVKIEARENTLNLVGATEDTIRRNAPQQSLPNPPQPKPPASTGHASPAG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|307728076|ref|NC_014539.1|:582363-582974 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGATGCAGCAGCTTCGAACCGGAGCAATCGTCCTGACCATGCTCGCCCTCGGCGGGTGCGGAGTCGGGC
AGACGGTCAAGGACAGCACGGTGGACGCAGCAAAGTGGGCATTCACGACGCAGGTGAAAACGATGAACAT
CGACCTCACGAGCCGCTCGTCGTTGAACGCAAGTGGCGACGGACAATCGTTGTCGACGGTGATACGGATC
TACCAGTTGAAGACGCCGCAGACCTTCCAGCAGCTCGACTACCAGCAGTTGCAAGCGAACGACCTGGAGG
CGCTGAAAGCCGACCTGCTGGCAACGAAAGACGTCGTGCTGCGCCCGGACGCCAGCGCGAGCATCAGCGA
GCCGATGAACGGCGACGCGCAATATGTCGGCGTCGTTGCATTTTTCCGCAATGCGGGCAGCGACGCGACA
TGGAAGCTCGTCATTCCGAAGAAGCAGTGGAAGAAGACGGACCCGGTGAAGATCGAGGCACGCGAAAACA
CACTCAATCTGGTCGGCGCGACCGAGGACACCATCCGGCGCAATGCACCGCAACAGAGCCTGCCGAATCC
GCCCCAGCCCAAGCCGCCTGCGTCGACCGGTCACGCAAGCCCGGCGGGCTAG