SecReT6
Protein ID: 307729026
SecReT6 ID496
T6SS typeN/A
Gene symbol-
Locus tagBC1003_0976
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]1107096..1107527 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE1TC39
KEGG IDbgf:BC1003_0976
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.10E-18, Aligned region: 31..114
Protein Sequence: 143 a.a.     [Download]
>gi|307729026|ref|YP_003906250.1| type VI secretion system lysozyme-like protein [Burkholderia sp. CCGE1003]
MPAGPSLYDMLLGQIDGEPLANHDDKTLEILSVQANIRRILNTRAGALKHVPDYGLPDLTEIYRNLPASV
HDLRNQMENTLLKFEPRLRAVEIEIDQKPDPGLLVSFIMICHLRRSGLVRFGTHFEPPGRMHVRRLVNSD
HNR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c1107527-1107096 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGCCCGCAGGACCGTCCCTTTATGACATGCTGCTCGGTCAGATCGATGGTGAGCCGCTCGCGAACCATG
ACGACAAAACACTTGAAATCCTGAGCGTCCAGGCCAACATCCGGCGCATCCTCAACACGCGTGCCGGCGC
GCTCAAGCACGTCCCTGACTATGGACTGCCCGACCTCACCGAGATATACCGGAATCTGCCCGCATCGGTT
CACGATCTGCGCAACCAGATGGAGAACACACTACTCAAATTCGAGCCGCGCCTACGTGCGGTCGAGATCG
AGATTGACCAGAAGCCCGATCCCGGTCTGCTGGTGAGCTTCATCATGATCTGCCATCTCCGCCGATCAGG
GCTGGTCCGTTTTGGGACGCATTTTGAACCGCCAGGCCGCATGCACGTCAGGCGTCTCGTGAACTCCGAC
CACAACCGTTAA