SecReT6
Protein ID: 307729027
SecReT6 ID496
T6SS typeN/A
Gene symbol-
Locus tagBC1003_0977
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]1107541..1108299 [-]
ProductClp domain-containing protein
NoteTssH
UniProt IDE1TC40
KEGG IDbgf:BC1003_0977
PDB IDNA
Domain hit(s) vs Pfam Clp_N [PF02861], Evalue: 0.00064, Aligned region: 33..83
ClpB_D2-small [PF10431], Evalue: 0.0029, Aligned region: 181..212
Protein Sequence: 252 a.a.     [Download]
>gi|307729027|ref|YP_003906251.1| Clp domain-containing protein [Burkholderia sp. CCGE1003]
MTVLNDRNHFSRDTNQLLQRLNPHCAKALEAAASMCQGRLSDEITVEHWLLKLIEAGDGDIPAIMHHYDL
NIDAVWDALLRAIDHTPRNLRGRPSLSPQLAAILQDAWFIASSGDTSGDPVIRSGNILQAIIEAPHALRA
NHAWQLLSVSSAQIPRLLPRLAQPTCENQTQEQEQEPEALCLSRESGARNVDEFLNQRILPTVSRELLTR
MASGAVPARIALFSSPEGNLTIDFIDRGETDAQTRVPELPVG
 
Nucleotide Sequence: 759 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c1108299-1107541 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGACCGTGCTCAACGACCGAAACCATTTCTCCCGTGACACGAACCAGCTCCTGCAGCGACTCAATCCCC
ACTGTGCAAAGGCACTTGAAGCTGCCGCAAGCATGTGCCAGGGAAGACTTTCGGACGAGATTACGGTCGA
GCACTGGCTGCTCAAGCTGATCGAGGCTGGGGACGGCGATATCCCGGCCATCATGCACCACTACGACCTG
AACATCGACGCCGTGTGGGATGCGCTACTCAGAGCCATTGATCACACGCCGCGCAACCTGCGTGGCCGTC
CCAGCCTCTCGCCGCAACTCGCCGCTATTCTCCAGGATGCCTGGTTTATTGCGTCTTCGGGCGACACGAG
CGGCGATCCGGTGATCCGCTCTGGGAATATCTTGCAGGCCATCATCGAAGCGCCGCATGCGCTTCGCGCG
AACCATGCCTGGCAACTACTCTCCGTCAGTAGTGCGCAGATTCCGCGACTCCTGCCGCGCCTCGCGCAGC
CTACCTGCGAGAACCAGACTCAGGAGCAAGAGCAGGAGCCAGAAGCACTGTGCCTTTCGCGCGAATCCGG
GGCGCGCAATGTGGACGAGTTCCTTAACCAGCGCATCCTGCCCACGGTCTCACGCGAGCTGCTCACGCGC
ATGGCAAGCGGCGCGGTGCCCGCCAGGATCGCCCTGTTCAGCTCGCCCGAGGGCAATCTCACAATCGACT
TCATCGACCGTGGCGAGACTGATGCCCAAACACGGGTTCCCGAGTTGCCGGTTGGCTGA