SecReT6
Protein ID: 307729030
SecReT6 ID496
T6SS typeN/A
Gene symbol-
Locus tagBC1003_0983
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]1114719..1115840 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDE1TC43
KEGG IDbgf:BC1003_0983
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-80, Aligned region: 19..336
Protein Sequence: 373 a.a.     [Download]
>gi|307729030|ref|YP_003906254.1| type VI secretion protein [Burkholderia sp. CCGE1003]
MKPHDLHNVEPLVASLLARAPWMSFMQLCRLLELRAPERPGFGTRDTPGHEPVRFGSWPRVGFPAGEIAT
VEFGDPSDPCGPHAPPIVRTTFMGLYGVDAAVPPHMIDDIALREEGHERVEAFLDRFNHRLVTLLYRAWK
KYRYAESFRPGGSDTHSRNLLCLVGFGWGSKPERAGVPDCRMLALLGLLSLKTRTAEGLAGVIALAVPGV
DVRVDEFFPAMTGTGQPRPLTSHHAATPSGERVKKGLGGGYVLGRRLAYRSRAVRVTLRPENARHARDLL
PGAWLHRELMAFVRLYVGVKADVHLRMEVSSRLAPFPAIGSAPVGPAPRLGWTTVLPADEERLITIPLGV
CEAFASPPPNPYLSPQPAYPGNR
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|307728076|ref|NC_014539.1|:1114719-1115840 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGAAACCGCACGATCTTCACAACGTCGAGCCGCTCGTTGCATCCCTGCTTGCGCGCGCGCCGTGGATGA
GCTTCATGCAACTGTGCCGCCTCCTTGAGCTGCGCGCGCCTGAGCGTCCGGGATTTGGCACGCGTGATAC
GCCCGGGCACGAGCCTGTGCGTTTCGGGTCGTGGCCCCGCGTCGGGTTTCCGGCGGGTGAGATCGCCACG
GTGGAGTTCGGTGATCCATCGGACCCTTGCGGGCCGCACGCGCCACCGATCGTGCGTACGACCTTCATGG
GTCTGTACGGCGTCGATGCGGCGGTACCGCCGCACATGATCGACGACATCGCCCTGCGTGAAGAAGGGCA
TGAACGGGTCGAAGCCTTTCTCGACCGCTTCAATCATCGCCTCGTTACGCTGCTGTACCGGGCCTGGAAA
AAATACCGCTACGCGGAGAGCTTCCGCCCGGGAGGCAGCGATACGCATTCGCGCAACCTGCTGTGTCTCG
TCGGGTTTGGCTGGGGCAGCAAACCTGAGCGCGCCGGGGTGCCCGATTGCCGGATGCTCGCGCTGCTGGG
CCTGCTGAGCCTGAAGACCCGGACGGCGGAAGGTCTGGCGGGTGTGATCGCGCTGGCGGTGCCGGGCGTC
GATGTGCGCGTCGACGAATTTTTCCCTGCGATGACGGGTACCGGTCAGCCGCGGCCGCTCACTTCGCATC
ACGCAGCCACGCCGTCGGGAGAACGGGTGAAGAAGGGGTTGGGGGGCGGTTATGTGCTGGGCCGGCGCCT
TGCCTATCGCAGTCGCGCCGTGCGGGTCACGCTGCGCCCCGAGAACGCGCGGCATGCGCGCGACCTGCTG
CCCGGGGCGTGGCTGCATCGCGAACTAATGGCGTTCGTACGGCTATACGTCGGAGTCAAGGCTGACGTTC
ATCTTCGCATGGAGGTGTCGTCACGCCTCGCCCCGTTTCCAGCGATCGGGAGTGCACCGGTGGGCCCTGC
ACCGCGACTCGGATGGACGACCGTGCTGCCCGCCGATGAGGAACGGCTGATTACCATCCCGCTTGGTGTA
TGTGAGGCCTTCGCGTCACCGCCGCCCAATCCATATCTGAGCCCACAACCCGCATATCCGGGGAACCGTT
GA