SecReT6
Protein ID: 307729031
SecReT6 ID496
T6SS typeN/A
Gene symbol-
Locus tagBC1003_0984
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]1115840..1116370 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE1TC44
KEGG IDbgf:BC1003_0984
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.90E-37, Aligned region: 13..161
Protein Sequence: 176 a.a.     [Download]
>gi|307729031|ref|YP_003906255.1| type VI secretion lipoprotein [Burkholderia sp. CCGE1003]
MSIRLTVITVSSALLLSACGAWQAVSDSTSNAYHAVFYRQVKVLNVDLSAREALNPDDAGRATSVAVRVY
QLRDRKLFDGASYDDLLKNDRTVLAQDLQASMAAVLNPGASASLAQPMQPDTKYVAIVAFYRNPGSGDGW
KYVIAKKKLDADKPLKLELVDQLLVAPDGTSQNTSR
 
Nucleotide Sequence: 531 bp     [Download]
>gi|307728076|ref|NC_014539.1|:1115840-1116370 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGTCTATCCGTCTGACCGTTATTACCGTGTCATCTGCCTTGCTGCTGTCGGCCTGCGGCGCGTGGCAGG
CCGTTTCCGACTCGACGTCGAACGCGTACCACGCCGTTTTCTACAGGCAGGTCAAGGTGCTCAACGTCGA
TCTGTCCGCCCGTGAAGCACTGAATCCGGACGATGCGGGTCGCGCGACCTCAGTCGCGGTGCGCGTCTAC
CAGCTCAGGGACCGCAAACTGTTCGATGGCGCGTCGTACGATGATCTCCTGAAGAACGACCGGACCGTGC
TCGCCCAGGATCTGCAGGCGAGCATGGCCGCCGTGCTCAACCCGGGGGCATCCGCGAGTCTCGCGCAGCC
CATGCAGCCCGATACGAAGTATGTGGCGATCGTTGCGTTCTACCGTAATCCGGGCTCCGGCGATGGATGG
AAATACGTGATCGCGAAGAAAAAGCTCGACGCTGACAAGCCGTTAAAGCTAGAACTGGTTGACCAGTTGC
TCGTTGCCCCGGATGGCACGTCACAGAACACCTCGCGGTGA