SecReT6
Protein ID: 307731117
SecReT6 ID497
T6SS typeN/A
Gene symbol-
Locus tagBC1003_3102
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]3618414..3619514 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE1TAM1
KEGG IDbgf:BC1003_3102
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-81, Aligned region: 18..334
Protein Sequence: 366 a.a.     [Download]
>gi|307731117|ref|YP_003908341.1| type VI secretion protein [Burkholderia sp. CCGE1003]
MKPRDLPNVEPLVAALLARAPRMNFMQLCRLLEARMPDRPGLGQCDTLAHEPVRFRPRPGMGFPASEIES
VEFNDNGDGNDGASLAPTVRMTFMGLYGVDATMPTSYLDDIVEREEGHEAVEAFLDQFNHRIVTLLYRAW
KKYRYPETYRYGGTDAHSRNLLCLMGLGWGNKPARSGLPDARALALLGLMIQRTRTPEGLAGVVALGAPG
VNVRVDEFWPVAKRIGKTQPLTAKSVHENVGRRGLGGGYVLGTRLPYRSRAVRVTVAPQNAQQARDLLPG
AWLHRDVMALVKIYMGTKADVHMRMQMSSRFAPEPAVGNLGTEGAPRLGRTVMLPTPHERVITVELGVCE
AFPSPQPNPFLQPRAA
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c3619514-3618414 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
GTGAAGCCGCGAGATCTCCCCAATGTCGAGCCGCTGGTCGCGGCGCTGCTCGCACGCGCCCCGCGCATGA
ATTTCATGCAGTTGTGCAGGCTGCTCGAAGCGCGCATGCCGGATCGCCCGGGACTCGGCCAATGTGACAC
GCTCGCACACGAGCCGGTGCGTTTCCGTCCCCGTCCGGGCATGGGCTTTCCCGCAAGCGAGATTGAGAGC
GTCGAGTTCAACGACAACGGTGACGGCAATGACGGCGCTTCCTTGGCACCCACCGTTCGTATGACCTTCA
TGGGTCTCTACGGCGTGGACGCGACGATGCCCACGAGCTACCTCGACGATATCGTCGAACGGGAGGAGGG
GCACGAAGCCGTCGAAGCTTTTCTCGATCAGTTCAATCATCGCATCGTCACGCTGCTGTACCGTGCGTGG
AAAAAATACCGCTACCCTGAAACGTACCGCTACGGCGGCACGGATGCGCATTCGCGCAATCTGTTGTGTC
TGATGGGATTGGGTTGGGGTAACAAGCCTGCCCGTTCAGGCCTGCCCGACGCGCGCGCCCTCGCGCTGCT
GGGTCTCATGATCCAGCGTACTCGGACCCCCGAAGGACTAGCAGGCGTGGTCGCGCTGGGCGCACCGGGC
GTCAATGTCCGCGTTGACGAGTTCTGGCCGGTGGCGAAGCGCATCGGCAAGACGCAGCCGCTGACCGCGA
AAAGTGTGCATGAAAACGTCGGTCGGCGCGGACTCGGTGGCGGTTATGTGCTCGGCACGCGTCTGCCGTA
TCGAAGCCGCGCTGTGCGCGTAACCGTCGCGCCGCAGAACGCGCAACAGGCGAGAGATTTGCTGCCCGGC
GCATGGTTGCATCGGGACGTGATGGCGCTAGTCAAAATCTATATGGGCACGAAGGCCGACGTGCACATGC
GCATGCAGATGTCTTCGCGCTTTGCGCCCGAGCCGGCGGTGGGCAACCTAGGGACGGAAGGAGCGCCCCG
GCTTGGCCGGACCGTCATGCTACCGACTCCACACGAACGCGTCATTACGGTCGAACTAGGCGTGTGCGAG
GCGTTTCCGTCGCCGCAGCCGAACCCCTTTCTGCAGCCGCGCGCGGCATAA