SecReT6
Protein ID: 307731118
SecReT6 ID497
T6SS typeN/A
Gene symbol-
Locus tagBC1003_3103
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]3619511..3621418 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE1TAM2
KEGG IDbgf:BC1003_3103
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.00E-177, Aligned region: 39..632
Protein Sequence: 635 a.a.     [Download]
>gi|307731118|ref|YP_003908342.1| type VI secretion protein [Burkholderia sp. CCGE1003]
MTSAELFTDYRFTRMHMAYNRGGGSDPENQTEHPGQDPMLRYYEAEMRYLREAGREFARAHPDRARMLHL
DRVGDRDPYVERLYEGFAFLTGRLQQKLDDELPELTEGLVSLLWPHYLRMIPSLSVVEFVPLAKKHERTE
QVPAGVKVRSKPISVSNAFGDGTAQKTVQCLYRTTQAVDLHPLRLVQAGPSVRHDGRSVIRLAFRLDPAA
KRNETDLSRLRMYLSADQPTAFTMYLAFTRQIQTIEWRIPEVRDGEAQALNGVTIEPAGFSHEERLWPNS
DAAFSGYQLLLEYFTFREKFLFVDVCGLDIDSLPEGSMQFQLEIVLKERYPSDHRFTEDNVRLFCTPVIN
LFELDAEPVAIDHHETEYRAIPAGHHGKHTETYSVDRVVGFDHVSAERYEYVPFSTFRHRGGMLRHESPE
RYFHTRVRPGIAGLHETWLIFGGNAWEAMEDLPEESVSLRVTGTNGMLPRKGLREALLDELVHGASEIAG
VRNLVAPTMPLYPPAGDRFQWRVLSHLAPNFLSMMDAEVLRGALALYDWTDDELNRRRLAGILHVSEELL
EEVTGGAVERGVLIEVTLDSYAFSGEGDVMLFGELLHRFFELYAEVNLFTKLAIVSLPTQARTEWPRSKT
YRAPL
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c3621418-3619511 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGACGTCGGCAGAACTCTTCACTGACTACCGCTTCACGAGAATGCATATGGCATACAACAGGGGAGGCG
GAAGCGACCCAGAAAACCAGACTGAGCATCCGGGCCAGGATCCGATGCTGCGCTACTACGAAGCCGAGAT
GCGCTACCTGCGCGAAGCTGGGCGTGAGTTCGCACGGGCACATCCGGACCGTGCGCGCATGCTCCATCTC
GATCGCGTGGGTGACCGCGATCCCTATGTCGAACGCCTCTACGAGGGCTTTGCGTTTTTGACTGGCCGGC
TCCAGCAGAAGCTTGACGACGAACTGCCCGAACTCACCGAGGGCTTGGTGAGCCTCTTATGGCCGCACTA
TCTGCGGATGATTCCCTCGCTGTCGGTCGTCGAATTCGTTCCGCTCGCCAAAAAGCATGAACGGACCGAG
CAGGTGCCGGCGGGGGTGAAAGTGCGGTCCAAGCCGATCTCCGTTTCGAACGCGTTTGGAGACGGCACCG
CGCAGAAGACAGTGCAATGTCTGTATCGCACGACGCAAGCTGTCGACCTGCACCCGCTGCGGCTAGTCCA
AGCCGGACCGTCCGTGCGCCACGACGGCCGCTCGGTGATCCGTCTCGCCTTCAGGCTCGATCCAGCGGCA
AAGCGCAACGAAACAGATCTCTCGCGGCTGCGCATGTACTTAAGCGCCGATCAGCCGACGGCGTTCACCA
TGTATCTGGCGTTCACACGCCAGATACAAACGATCGAGTGGCGTATCCCGGAAGTGCGCGACGGCGAGGC
CCAAGCGCTCAACGGCGTGACTATCGAGCCGGCAGGCTTCTCACATGAAGAGCGCTTGTGGCCCAACTCC
GACGCCGCGTTCTCCGGCTATCAGTTATTGCTCGAATACTTCACGTTCCGCGAGAAATTCCTATTCGTCG
ATGTGTGCGGACTTGACATCGACTCGCTGCCGGAAGGCTCGATGCAATTCCAGTTGGAGATCGTGCTGAA
GGAGCGGTATCCATCCGATCATCGGTTCACCGAGGACAACGTGCGGCTGTTCTGCACGCCGGTTATCAAT
CTGTTCGAGCTTGATGCAGAGCCGGTGGCCATAGACCACCATGAAACGGAGTATCGCGCGATTCCTGCTG
GCCACCATGGCAAGCACACCGAGACGTATTCCGTTGACCGTGTCGTCGGGTTCGATCACGTCTCTGCGGA
GCGTTACGAGTATGTTCCGTTTTCGACCTTCCGCCATCGAGGCGGAATGTTGCGGCACGAGTCGCCCGAA
CGGTACTTCCACACGCGCGTGCGCCCGGGGATAGCCGGACTACATGAGACCTGGCTCATTTTTGGCGGCA
ACGCTTGGGAAGCGATGGAAGACCTGCCGGAGGAGAGCGTATCACTCCGCGTGACCGGCACCAATGGAAT
GCTGCCGCGCAAGGGCCTGCGTGAAGCGCTTCTTGATGAGTTGGTGCATGGGGCGTCGGAGATCGCGGGT
GTGAGAAATTTGGTTGCGCCCACGATGCCGCTCTATCCGCCCGCGGGCGACCGCTTCCAGTGGCGCGTGC
TATCGCACCTCGCGCCAAACTTCCTATCGATGATGGATGCGGAGGTGCTGCGTGGCGCACTCGCGCTCTA
CGATTGGACCGATGATGAACTCAATCGCCGACGTCTCGCGGGCATTCTGCACGTCTCGGAAGAGTTGCTT
GAGGAGGTCACGGGCGGAGCAGTGGAGCGGGGCGTGCTCATCGAAGTGACGCTCGATTCCTACGCGTTTT
CCGGCGAGGGCGACGTGATGCTTTTTGGCGAGCTGCTGCATCGCTTCTTCGAGCTGTATGCTGAAGTCAA
TCTGTTCACGAAGCTCGCGATCGTGAGCCTGCCAACGCAAGCCCGCACCGAGTGGCCGCGCAGCAAGACG
TATCGGGCGCCGCTGTGA