SecReT6
Protein ID: 308186533
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1022
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1073370..1073867 [+]
Producttype VI secretion system, core protein
NoteTssJ
UniProt IDE1SAE0
KEGG IDpva:Pvag_1022
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.10E-27, Aligned region: 17..134
Protein Sequence: 165 a.a.     [Download]
>gi|308186533|ref|YP_003930664.1| unnamed protein product [Pantoea vagans C9-1]
MMRTTQLRGGLIVLLMWLLTACSSSSTPPVAYYNLDVQGQNQLNGGAPLKVRVVLLSSDAEFMSADFFSL
QNQSATVLGSAQLNTQQFFLTPEQRSKTLRIKSLPEARFIGIMAEYQALDGKVWRLSLPVPEGESPSFWA
FWKRDDSELNARIVAGINGLHVEKQ
 
Nucleotide Sequence: 498 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1073370-1073867 Pantoea vagans C9-1 chromosome, complete genome
ATGATGAGAACAACACAACTGCGCGGTGGGCTGATCGTGCTGCTGATGTGGCTGCTGACGGCCTGCAGCA
GTAGCAGTACGCCGCCGGTGGCTTACTATAACCTGGACGTTCAGGGGCAGAATCAGCTTAACGGCGGTGC
GCCGCTGAAGGTCCGTGTGGTGTTACTAAGCTCCGATGCGGAGTTCATGTCAGCAGACTTCTTCTCCCTG
CAAAACCAGTCCGCAACGGTGCTGGGCAGTGCGCAGCTTAACACCCAGCAATTCTTCCTGACGCCAGAGC
AGCGCAGCAAAACGCTGCGGATTAAGAGCCTGCCTGAGGCGCGCTTCATCGGCATCATGGCGGAATATCA
GGCGCTGGATGGCAAGGTGTGGCGACTGTCGCTGCCGGTTCCCGAAGGGGAGTCACCCTCATTCTGGGCA
TTCTGGAAACGTGACGATAGCGAGCTGAATGCGCGCATCGTGGCGGGAATTAATGGCCTTCACGTGGAAA
AACAGTGA