SecReT6
Protein ID: 308186534
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1023
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1073873..1075213 [+]
Producttype VI secretion system, core protein
NoteTssK
UniProt IDE1SAE1
KEGG IDpva:Pvag_1023
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-147, Aligned region: 19..442
Protein Sequence: 446 a.a.     [Download]
>gi|308186534|ref|YP_003930665.1| unnamed protein product [Pantoea vagans C9-1]
MNRAEKVVWTEGMFLRPHHFQQSENYLLSTLREWGQSQRVYTWGFYDLEFDEALLRQGKLALSAASGCLP
DGTFFAFSQPQHGPAPLDLPASVDRSKVVLAIPTRRNGREAVAFQESQDSLARYLAWEAEVEDDNAQAVG
SATVQFGKLRLRLMLEQDLTAEWTAMGVAQVIEKRSDNHIRLDSDYIPPMLTLNSSRPLQNMFNDLHGLI
QQRSQQLSQRAPGTGRFNSADMVDFMLLALLNRQLGLHSHLQHLPLLHPETLYSHWLQLAAELSTWTPAR
APEGLPLYDHDDLHNCFSRLSLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPESSMVHEFGFVLAVKA
SVPADTLKTHFPAQMKVAPVSKIRDLVQLQLPGLALRAMPGAPPQIPWHAGYSYFELDKNSELWKEMERS
GAFALHLAGEFPGLNMEFWAIRSQSE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1073873-1075213 Pantoea vagans C9-1 chromosome, complete genome
ATGAACAGAGCCGAAAAGGTCGTCTGGACCGAGGGGATGTTTCTGCGTCCTCACCATTTCCAGCAGTCAG
AAAATTATCTTCTCAGCACCCTGCGTGAATGGGGTCAGTCACAGCGCGTTTACACCTGGGGCTTTTACGA
TCTGGAGTTTGATGAAGCGCTGCTGCGTCAGGGGAAACTGGCGCTGAGTGCGGCCAGCGGCTGTCTGCCA
GACGGCACGTTTTTCGCCTTCAGCCAGCCGCAACATGGCCCGGCACCGCTTGATCTGCCAGCTTCTGTTG
ACCGCAGCAAAGTGGTGCTGGCGATACCGACCCGTCGCAATGGCCGCGAAGCCGTCGCTTTCCAGGAGTC
GCAGGATTCTCTGGCGCGCTATCTGGCCTGGGAAGCGGAAGTGGAAGATGACAACGCCCAGGCCGTAGGC
AGCGCGACGGTACAGTTCGGCAAGCTGCGCCTGCGGCTGATGCTGGAGCAGGATCTGACCGCCGAGTGGA
CCGCGATGGGCGTTGCGCAGGTGATTGAAAAACGCAGCGACAACCATATCCGGCTCGACAGCGATTACAT
CCCGCCGATGCTGACTCTGAACAGCAGCCGTCCGCTGCAAAACATGTTTAACGACCTGCACGGGCTGATC
CAGCAGCGCAGCCAGCAACTGAGTCAGCGTGCACCCGGCACCGGCCGCTTCAACAGCGCCGATATGGTCG
ATTTTATGCTGCTGGCGCTGCTCAATCGTCAGCTTGGCCTGCACAGCCATCTGCAACATCTGCCGCTGCT
GCATCCTGAAACCCTCTACAGCCACTGGCTGCAACTGGCCGCAGAGCTGAGTACTTGGACGCCCGCGCGC
GCGCCGGAAGGACTGCCGCTCTACGATCATGATGACCTGCATAACTGCTTCAGCCGTCTGTCGCTGCTGC
TGCGTCAGGGTCTGTCGCAGGTGATGGAGGAGAGCGCCATTCAGCTGCCACTGACGCAGCGTTCGCACGG
CCTTAACGTCGCTACCGTGCCGGAGAGCAGCATGGTGCATGAGTTCGGCTTTGTGCTGGCGGTGAAAGCC
AGCGTGCCGGCCGACACCCTGAAAACCCATTTCCCGGCACAGATGAAAGTCGCGCCGGTCAGCAAAATCC
GCGATCTGGTGCAGCTGCAGCTGCCGGGTCTGGCACTTCGGGCGATGCCCGGCGCGCCGCCGCAGATCCC
GTGGCATGCCGGATACAGCTATTTCGAACTGGATAAGAACAGCGAGCTATGGAAAGAGATGGAGCGCTCG
GGCGCTTTTGCGCTGCATCTTGCCGGTGAGTTTCCGGGCCTGAACATGGAGTTCTGGGCCATCCGCAGTC
AGTCAGAATAA