SecReT6
Protein ID: 308186535
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1024
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1075231..1076469 [+]
Producttype VI secretion system, core protein
NoteTssL
UniProt IDE1SAE2
KEGG IDpva:Pvag_1024
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-69, Aligned region: 20..225
DUF2077 [PF09850], Evalue: 2.10E-69, Aligned region: 355..389
OmpA [PF00691], Evalue: 2.90E-15, Aligned region: 290..388
Protein Sequence: 412 a.a.     [Download]
>gi|308186535|ref|YP_003930666.1| unnamed protein product [Pantoea vagans C9-1]
MMQEQQHSHSDLAPDASHQNVLVAAANPLINAIPQIRHSVSHEDPAQLRQQLIDQIRRFELSCQQSGLGY
EVIIGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQLLAKLSQNPRRHILMLELIY
FCLLLGFEGRYRVLDNGRSQLETIKQRLLQMIKSVRGSYAAALSPHPTDQPVLRKLWRPMIPLWACAAVA
GLAACLFYIVLNWRLGDYTSPVLARIYQTALPEVKIGNPAPPPPATLNLRAFLKPEIDAGLVAVRDEADR
SVVTLKGDGLFASAATEVRGGYIDVIRRIAAAMNNVSGQIQVIGYSDNVPIRSARFASNFELSLARARSV
QTLLQQQLAQPSRVKAEGRGESNPLVPNTSAENRARNRRVEITLLVAPDATHAELNGLARGN
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1075231-1076469 Pantoea vagans C9-1 chromosome, complete genome
ATGATGCAGGAACAACAACATTCACACAGCGATCTTGCGCCGGATGCCAGCCACCAGAATGTGCTGGTTG
CGGCGGCCAACCCCCTGATTAACGCGATTCCACAGATCCGCCATTCGGTGTCGCATGAAGACCCGGCGCA
ACTGCGTCAGCAGCTGATCGACCAGATCCGCCGCTTTGAGCTGAGCTGTCAGCAGTCGGGCCTCGGCTAC
GAAGTGATCATCGGCGCGCGCTACTGTCTCTGTACCGCGCTGGATGAGGCGGCGGCGCTGACGCCGTGGG
GCAGTCGCGGCGTCTGGACCAGCAACGGTCTGCTGGTCACCTTTCATAACGAAACCTGGGGCGGCGAGAA
GTTTTTCCAGCTGCTGGCGAAGCTGTCGCAGAACCCCAGACGTCACATTCTGATGCTGGAGCTGATCTAC
TTCTGCCTGCTGCTGGGGTTCGAAGGACGCTACCGGGTGCTGGACAATGGCCGCTCGCAGCTGGAGACCA
TCAAACAGCGCCTGCTGCAGATGATCAAAAGCGTACGCGGCAGTTACGCCGCGGCGCTGTCACCGCATCC
CACCGATCAGCCGGTGCTGCGCAAGCTATGGCGGCCGATGATCCCGCTGTGGGCCTGTGCGGCCGTGGCT
GGGCTGGCCGCCTGTCTGTTCTACATCGTGCTCAACTGGCGTCTGGGTGATTACACCTCGCCGGTGCTGG
CCCGCATCTATCAGACGGCGCTGCCGGAAGTGAAGATTGGCAACCCGGCGCCGCCTCCGCCTGCCACGCT
GAATCTGCGCGCCTTCCTGAAGCCGGAAATTGATGCCGGGCTGGTGGCGGTGCGTGATGAAGCGGACCGC
AGCGTGGTGACGCTGAAAGGGGATGGGCTATTTGCTTCGGCGGCGACCGAAGTGCGCGGCGGCTACATTG
ACGTGATCCGGCGCATCGCGGCGGCCATGAACAACGTCAGCGGCCAGATTCAGGTGATTGGCTACAGCGA
TAACGTGCCGATCCGCAGCGCGCGCTTCGCCTCCAACTTTGAGCTGTCGCTGGCGCGCGCCCGTTCGGTG
CAGACCCTGCTGCAACAGCAGCTGGCGCAGCCGTCGCGGGTGAAAGCGGAAGGGCGCGGCGAAAGCAATC
CGCTGGTGCCGAACACCAGCGCAGAAAATCGCGCGCGTAACCGTCGTGTTGAAATCACACTGCTGGTGGC
GCCGGATGCGACGCATGCCGAACTCAACGGTCTGGCGAGAGGGAACTGA