SecReT6
Protein ID: 308186538
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1027
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1080844..1081866 [+]
Producttype VI secretion system, core protein
NoteTssA
UniProt IDE1SAE5
KEGG IDpva:Pvag_1027
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-18, Aligned region: 54..113
Protein Sequence: 340 a.a.     [Download]
>gi|308186538|ref|YP_003930669.1| unnamed protein product [Pantoea vagans C9-1]
MTMNTEALLAPVSDDNPGGDNLEYDADFQAMEQASAGKAEQQFGNTIIPAEPADWNKVEKLAIALLARSK
DLRVMLALTHAWTELKGLPGYAQGLKLIEQALLLYWEPLWPRLEEYGEQDPFYRINALALLGDKTELSGA
VRQCWLLRYPSDGITLRDAAALCDGSKTEVADYPGGLPRLIDELARGDQPGIEAVLQIHERLQTICETVA
ERLGDAAVPELALLRRQIALIAERCQATDISQLIPTAAAEQPAEAAAPAAVATAPRAAADWRTVQISSRA
DAQLMLEKVKLYFTQHEPSHPAPLMIDRVQRLIERDFLEIIRELAPDGVHQLETIFGRRD
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1080844-1081866 Pantoea vagans C9-1 chromosome, complete genome
ATGACGATGAATACAGAGGCTTTGCTGGCTCCGGTCAGTGATGACAATCCCGGTGGCGATAACCTGGAGT
ACGACGCCGATTTTCAGGCGATGGAGCAGGCCAGTGCCGGTAAAGCGGAACAGCAGTTCGGTAACACCAT
CATTCCGGCGGAACCCGCCGACTGGAACAAAGTTGAGAAGCTGGCGATAGCGCTGCTGGCCCGCAGTAAA
GATTTACGGGTGATGCTGGCGCTGACCCACGCCTGGACCGAACTGAAAGGGCTGCCGGGCTACGCCCAGG
GCCTGAAGCTGATTGAACAGGCGCTGCTGCTCTACTGGGAGCCGCTGTGGCCCCGGCTGGAAGAGTACGG
CGAGCAGGACCCGTTCTACCGCATCAATGCCCTGGCGCTGCTGGGTGACAAGACTGAACTCAGTGGTGCG
GTGCGTCAGTGCTGGCTGCTGCGCTATCCGTCCGACGGTATCACGCTGCGTGATGCAGCCGCCCTGTGCG
ACGGCAGCAAAACCGAGGTGGCAGACTATCCCGGCGGCCTGCCGCGTCTGATCGATGAACTGGCACGCGG
CGACCAGCCCGGCATTGAGGCGGTGCTGCAGATTCATGAGCGGCTGCAGACCATCTGCGAAACCGTGGCC
GAACGGCTGGGCGACGCGGCGGTGCCTGAACTGGCCCTGCTGCGCCGACAGATTGCGCTGATCGCCGAAC
GCTGCCAGGCCACCGATATCAGCCAGCTGATACCCACCGCAGCGGCGGAACAACCCGCAGAAGCGGCGGC
CCCGGCGGCGGTCGCAACGGCGCCGCGCGCGGCCGCGGACTGGCGCACGGTACAGATCAGTTCCCGCGCC
GATGCCCAGCTGATGCTGGAGAAAGTGAAGCTCTACTTCACCCAGCATGAGCCGAGCCACCCGGCTCCGC
TGATGATCGACCGGGTACAGCGCTTAATCGAGCGCGACTTCCTGGAGATCATCCGCGAGCTGGCACCCGA
TGGCGTGCATCAGCTGGAAACCATTTTCGGACGTCGCGACTAA