SecReT6
Protein ID: 308186539
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1028
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1081946..1082479 [+]
Producttype VI secretion system, core protein
NoteTssB
UniProt IDE1SAE6
KEGG IDpva:Pvag_1028
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-59, Aligned region: 12..163
Protein Sequence: 177 a.a.     [Download]
>gi|308186539|ref|YP_003930670.1| unnamed protein product [Pantoea vagans C9-1]
MATSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLVGKPLEPQPGIDDRKFLEIDIDN
FDERMKALKPRAAFQVDNTLNGEGKLNIDLTFDSMDDFSPDAVARNVEPLSKLLEARTQLANLLTYMDGK
NGAEELIGKVLQDPTLLQALTHLPKQDEATEGKEPQA
 
Nucleotide Sequence: 534 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1081946-1082479 Pantoea vagans C9-1 chromosome, complete genome
ATGGCAACAAGCAAATCCAGTGGGCAGAAGTTCATTGCCCGCAATCGCGCGCCTCGCGTTCAGATTGAAT
ATGACGTGGAAATTTATGGCGCGGAACGCAAAATCCAGCTGCCGTTTGTGATGGGCGTGCTGGCGGATCT
GGTGGGTAAACCGCTGGAGCCGCAGCCGGGCATCGACGACCGCAAATTCCTTGAGATCGACATCGACAAC
TTCGATGAGCGCATGAAAGCGCTGAAGCCACGCGCCGCGTTCCAGGTAGACAACACCCTGAACGGCGAAG
GCAAGCTCAACATCGATCTCACTTTCGACAGCATGGACGACTTTTCGCCGGATGCCGTGGCCCGCAACGT
CGAGCCGCTGAGCAAGCTGCTGGAAGCGCGTACCCAGCTGGCAAATCTGCTGACCTATATGGACGGCAAA
AACGGTGCGGAAGAGCTGATTGGTAAAGTGCTGCAGGACCCAACGCTGCTGCAGGCTCTGACCCATCTGC
CTAAGCAGGATGAGGCCACTGAAGGTAAGGAGCCGCAGGCATGA