SecReT6
Protein ID: 308186540
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1029
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1082476..1083975 [+]
Producttype VI secretion system, core protein
NoteTssC
UniProt IDE1SAE7
KEGG IDpva:Pvag_1029
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.20E-198, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|308186540|ref|YP_003930671.1| unnamed protein product [Pantoea vagans C9-1]
MTQTSQQPQSQGAASFSQDEFSALLNKEFRPKSDQARAAVESAVKTLAQQALENTVTVSSDAYRTIQALI
AEIDEKLSQQVNQIIHHPEFQSLESAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGAGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPEVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLARLPYGIRTNPVDSFDFEEQTDGSDHGNYTWSN
AAYAMAANINRSFKEYGWCTAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPTEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKNDNA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1082476-1083975 Pantoea vagans C9-1 chromosome, complete genome
ATGACGCAGACTTCACAACAACCCCAGTCGCAGGGCGCGGCAAGTTTCAGCCAGGATGAGTTCAGCGCGC
TGCTGAACAAAGAATTCCGGCCGAAAAGCGATCAGGCACGTGCCGCGGTCGAGAGCGCGGTAAAAACTCT
GGCGCAGCAGGCGCTGGAGAACACCGTCACCGTTTCCAGCGACGCCTATCGCACCATTCAGGCGCTGATC
GCGGAGATCGACGAAAAGCTGTCGCAGCAGGTTAACCAGATTATTCACCATCCGGAGTTTCAGTCGCTGG
AGAGCGCCTGGCGCGGCCTGAGCTATCTGGTTAACAACACCGAAACGGATGAGATGCTGAAAATCCGTTT
TATGAGCATCTCCAAGCAGGAACTGGGTCGTACGCTTAAGCGCTATAAAGGTGCTGGCTGGGACCAAAGC
CCGCTGTTCAAGAAGATCTATGAGCAGGAGTATGGTCAGTTCGGCGGCGAGCCGTTTGGCTGTCTGGTGG
GCGACTATTACTTCGACCATAGCCCGCAGGATGTTGAGCTGCTGGGTGAGATGGCTCGCATCGGTTCGGC
GGCACACTGTCCGTTTATCACCGGCACCGCGCCGGAAGTGATGCAGATGGAATCCTGGCAGGAGCTGGCA
AATCCGCGCGATCTGACCAAAATCTTCCAGAACACCGAATATGCTGCCTGGCGCAGCCTGCGTGAGTCGG
AAGATGCACGTTATCTGGGCCTGGTGATGCCGCGTTTCCTGGCGCGTCTGCCATATGGCATTCGTACCAA
CCCGGTCGACAGCTTCGATTTTGAAGAGCAGACCGACGGTTCCGATCACGGCAACTACACCTGGAGCAAT
GCGGCGTATGCGATGGCCGCCAACATCAACCGCTCCTTTAAGGAGTATGGCTGGTGTACCGCAATCCGCG
GCGTAGAATCGGGCGGGGCGGTTGAGAACCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGTGGA
CATGAAGTGTCCGACCGAAATCGCCATCAGCGATCGCCGCGAAGCCGAACTGGCGAAAAACGGCTTTATG
CCGCTGGTGCATCGCAAAAACTCTGACTTCGCCGCCTTTATTGGCGCGCAGTCACTGCAGAAGCCGACGG
AATATCACGACGCCGATGCCACCGCCAATGCCCGTCTGGCCGCGCGTCTGCCTTATCTGTTCGCCTGCTG
CCGCTTTGCGCATTACCTGAAGTGCATCGTGCGTGACAAGATCGGCTCCTTCCGCGAGCGCGATGAGATG
GAACGCTGGCTGAACGATTGGGTGATGAACTACGTCGATGGCGATCCGGCTAACTCCTCGCAGGAGACCA
AGTCTCGTAAGCCGCTGGCCGCTGCCGAGGTGAATGTGGAAGAGCAGGAAGATAATCCGGGCTATTACGC
CGCGAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGCCTGACCGTTTCGCTGCGTCTGGTCTCTAAG
CTGCCGTCACTGAAGAATGATAATGCTTAA