SecReT6
Protein ID: 308186546
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1035
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1087748..1089607 [+]
Producttype VI secretion system, core protein
NoteFha
UniProt IDE1SAF3
KEGG IDpva:Pvag_1035
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.10E-07, Aligned region: 27..93
UreE_N [PF02814], Evalue: 6.50E-05, Aligned region: 32..49
UreE_N [PF02814], Evalue: 6.50E-05, Aligned region: 78..99
UreE_N [PF02814], Evalue: 6.50E-05, Aligned region: 205..219
Protein Sequence: 619 a.a.     [Download]
>gi|308186546|ref|YP_003930677.1| unnamed protein product [Pantoea vagans C9-1]
MRFTIITTKPGQQPPQTHCDFFPPGGTIGRGVDNNLVLPDDDRTLSRLQAIVHITANGECRLTNRGNVTR
VLLNDIPLERGRQVELQDGDILGIDDYQLLVSDLNSAQQPQAERAVPRPEPVQPAAAPREPVAEKASTTA
AIPSEIWDSLAKEFSISDDLSKRKAVPEMPDAHPLTAPAMPDRNPEDPLAQLINDAPLDYGQQPKNSSLF
DDGDALFAQQSIFDDRTPSTLAAQPHTTPKQAEAPTAELDPLSLFDGESSADVRNHDDPLGLMMGNAVPL
AQPEPAKPAALHVPPHQETKPEPVAPRSPEQASVSLNEMDHSPLFSGIDLPVDDQPHSESPRQTLLADEA
ESGQTDAVNPQNDYGGITLPTPQAVQRAPSPTPKGRLRIDPVASGHQHAAAVQPSTSSQSSGDALKGELL
DALLEGMGLRDLQPTPQFDREQMLQFGQMLSMFSQGTVALLSSRSILKRGVKADMTVILDDANNPFKLLP
SGKTVLMQMFGSRMPGFMPPRQAVRDALIDLQAHQLGMIAGIRAIIASMLQSFNPEQLEEEARQAGSVSR
IGLPGSRKAALWEHFVERYGETAGEIEDDFHTLFGEAFLHAYDLEVNQYKDSQTHTDDA
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1087748-1089607 Pantoea vagans C9-1 chromosome, complete genome
ATGCGCTTTACGATAATAACGACTAAACCCGGCCAACAGCCGCCGCAAACTCATTGTGATTTCTTTCCGC
CCGGCGGCACCATTGGTCGCGGCGTGGATAACAATCTGGTGCTGCCGGATGACGACCGAACGCTCTCCCG
GCTGCAGGCCATTGTGCACATCACCGCGAACGGTGAATGTCGTCTGACTAACCGTGGCAATGTGACGCGC
GTGCTGCTCAACGATATTCCGCTGGAACGCGGTCGTCAGGTTGAGCTGCAGGATGGGGACATTCTGGGCA
TCGATGATTATCAGCTGCTGGTCAGCGATCTCAATAGTGCGCAGCAGCCGCAGGCTGAAAGGGCGGTTCC
GCGTCCGGAGCCGGTCCAGCCCGCCGCGGCTCCTCGTGAACCGGTAGCCGAAAAAGCCAGTACCACCGCC
GCTATCCCCAGCGAAATCTGGGACAGTCTGGCGAAAGAGTTCTCGATTTCCGACGATCTCTCTAAACGCA
AAGCCGTGCCGGAAATGCCGGATGCCCATCCGCTGACCGCGCCCGCCATGCCGGACCGGAATCCGGAAGA
TCCACTGGCACAGCTAATCAATGATGCGCCGCTGGATTATGGTCAGCAGCCCAAAAACAGCAGCCTGTTT
GATGACGGTGATGCGCTCTTTGCGCAGCAGAGTATTTTTGACGACCGTACGCCGAGCACGCTGGCGGCTC
AGCCGCACACTACGCCAAAGCAGGCTGAGGCGCCTACTGCGGAACTGGATCCACTGAGCCTGTTCGACGG
CGAGAGCAGTGCGGATGTGCGCAACCATGATGATCCATTAGGACTGATGATGGGGAACGCGGTGCCGCTG
GCGCAGCCGGAGCCAGCGAAACCGGCGGCGCTGCATGTGCCGCCTCACCAAGAGACAAAGCCTGAGCCGG
TTGCCCCACGCTCACCTGAGCAGGCTTCCGTCAGCCTGAACGAAATGGATCACTCTCCGCTATTTAGCGG
CATCGACTTACCCGTTGATGACCAGCCTCATAGTGAATCCCCGCGCCAGACGCTGCTGGCGGATGAGGCA
GAGTCCGGTCAGACAGACGCTGTTAATCCGCAAAACGACTATGGCGGGATTACGCTGCCCACACCCCAGG
CGGTGCAGCGAGCTCCCTCACCGACGCCGAAAGGGCGGCTGCGCATTGATCCGGTTGCCTCGGGTCACCA
GCATGCCGCCGCCGTGCAGCCCTCCACATCCAGCCAGAGCAGCGGCGATGCGCTGAAAGGCGAACTGCTG
GACGCGCTGCTGGAAGGCATGGGTCTGCGCGATCTGCAGCCGACGCCGCAGTTTGACCGCGAGCAGATGC
TGCAGTTTGGTCAGATGCTCAGCATGTTCTCGCAGGGCACGGTCGCGCTGCTGTCATCGCGCTCGATCCT
TAAGCGCGGCGTTAAGGCTGACATGACGGTGATCCTCGACGACGCCAACAACCCGTTCAAGCTGCTGCCA
TCGGGCAAAACTGTCCTGATGCAGATGTTTGGCAGCCGGATGCCGGGCTTTATGCCACCACGTCAGGCGG
TGCGGGATGCGCTGATTGATTTGCAGGCGCACCAGCTGGGCATGATCGCCGGTATCCGCGCCATCATCGC
CTCGATGCTGCAATCCTTTAACCCGGAGCAGCTGGAGGAAGAGGCACGTCAGGCGGGATCGGTTTCCCGT
ATCGGCCTGCCGGGCAGCCGTAAAGCGGCGCTGTGGGAGCATTTTGTTGAGCGCTACGGTGAGACGGCGG
GCGAGATCGAAGACGATTTCCACACCCTGTTTGGCGAAGCGTTTCTGCACGCCTATGACCTGGAAGTTAA
TCAGTACAAAGACTCACAAACCCACACGGATGACGCATGA