SecReT6
Protein ID: 308186549
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1038
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1091400..1092227 [+]
Producttype VI secretion system-associated hypothetical protein
NoteTagJ
UniProt IDE1SAF6
KEGG IDpva:Pvag_1038
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.00E-39, Aligned region: 144..266
TPR_19 [PF14559], Evalue: 0.0019, Aligned region: 24..73
Protein Sequence: 275 a.a.     [Download]
>gi|308186549|ref|YP_003930680.1| unnamed protein product [Pantoea vagans C9-1]
MESLQHHLANATLSETLTDVTRQIQANPANADLRAAFVQLLCLAGNWTRAQTQLQSWLALSPQAQPTVNL
LQQAIAGELQRDAVLRGEAQPVLPGSAWHWCDTLLAALQAETAGDVARGSALRADALELAAANPGTATGQ
DQPTAFSWLMDGDSRFGPVCEVINQGRYYWIPFAAIREMQFQAPASVTDLVWRHTRVQLVDGSEQVCQIP
ARYPLLAGADERFLRTSVTEWQPLGNDPDQFIGQGQKMWLSDSAEFSLLSLQQVAFDNVESADEP
 
Nucleotide Sequence: 828 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1091400-1092227 Pantoea vagans C9-1 chromosome, complete genome
ATGGAATCCTTACAACATCATCTTGCGAACGCCACGCTCAGCGAGACGCTGACTGACGTTACCCGCCAGA
TTCAGGCCAATCCAGCGAACGCCGATCTGCGCGCCGCCTTTGTCCAGTTACTCTGCCTGGCGGGCAACTG
GACGCGTGCGCAGACGCAGCTGCAATCCTGGCTGGCGTTAAGCCCGCAGGCGCAACCAACGGTTAATCTG
TTGCAGCAGGCGATTGCCGGTGAGCTGCAGCGTGATGCCGTGCTGCGTGGCGAGGCACAACCCGTGCTGC
CGGGCAGCGCCTGGCACTGGTGCGACACACTGCTGGCCGCATTACAGGCCGAAACCGCGGGTGATGTCGC
GCGCGGCAGCGCACTGCGTGCCGACGCGCTGGAGCTTGCTGCCGCCAATCCCGGCACCGCGACCGGGCAG
GATCAGCCGACCGCCTTCAGCTGGCTGATGGATGGCGACAGCCGTTTCGGGCCGGTGTGTGAAGTGATCA
ATCAGGGCCGTTATTACTGGATCCCGTTCGCCGCCATTCGTGAGATGCAGTTCCAGGCACCCGCCAGCGT
CACCGATCTGGTGTGGCGTCATACTCGGGTGCAACTGGTGGATGGCAGCGAACAGGTGTGTCAGATCCCG
GCGCGCTATCCGCTGCTGGCGGGTGCGGACGAGCGTTTTCTGCGCACCAGCGTCACCGAATGGCAGCCGC
TGGGCAACGATCCGGACCAGTTTATCGGCCAGGGACAAAAAATGTGGCTCAGCGACAGCGCGGAGTTCTC
GCTGCTGAGCCTGCAGCAGGTCGCGTTCGATAACGTTGAGTCCGCCGATGAGCCATGA