SecReT6
Protein ID: 308186550
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1039
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1092217..1092792 [+]
Producttype VI secretion system, core protein
NoteTssE
UniProt IDE1SAF7
KEGG IDpva:Pvag_1039
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.10E-19, Aligned region: 60..169
Protein Sequence: 191 a.a.     [Download]
>gi|308186550|ref|YP_003930681.1| unnamed protein product [Pantoea vagans C9-1]
MSHDSGAHNDGYAQLHGGFRARKKRDALTARDKLQSSLLDRLTDNAPDKQQEPENSMLISHSTLRRHVLR
DLQWLFNTINNEAQQDLDGFDQVQRSVWNFGVAPLAGQNVSDIEWQDMQRKMTNAILHFEPRILPQGLQV
RCVSDLGSLSLHNVLSIEIKGRLWCVPYPLAFLFRTQVDLESGHFELQDAG
 
Nucleotide Sequence: 576 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1092217-1092792 Pantoea vagans C9-1 chromosome, complete genome
ATGAGCCATGATTCAGGCGCGCACAACGACGGCTATGCCCAGCTGCATGGCGGCTTTCGTGCGCGCAAAA
AGCGCGATGCGCTGACCGCCCGCGACAAACTGCAATCCTCGCTGCTGGACCGCCTGACCGACAACGCGCC
GGACAAACAGCAGGAGCCGGAGAACAGCATGCTGATCAGCCACAGTACGCTGCGCCGCCACGTGCTGCGC
GATCTGCAGTGGCTGTTTAACACCATCAACAACGAAGCGCAGCAGGATCTGGACGGTTTCGATCAGGTGC
AGCGCTCGGTCTGGAACTTCGGCGTAGCGCCGCTGGCCGGACAGAACGTCTCCGATATCGAATGGCAGGA
TATGCAGCGCAAAATGACCAACGCCATTCTGCACTTCGAGCCGCGTATTCTGCCGCAGGGTCTGCAGGTG
CGCTGCGTCAGCGATCTCGGCTCGCTTAGTCTGCACAACGTGCTGTCGATTGAGATCAAAGGGCGCCTCT
GGTGCGTGCCTTATCCGCTGGCGTTTCTGTTCCGCACTCAGGTTGATCTGGAGAGCGGCCATTTCGAACT
TCAGGATGCAGGGTAA