SecReT6
Protein ID: 308186551
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1040
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1092795..1094666 [+]
Producttype VI secretion system, core protein
NoteTssF
UniProt IDE1SAF8
KEGG IDpva:Pvag_1040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-214, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|308186551|ref|YP_003930682.1| unnamed protein product [Pantoea vagans C9-1]
MDSNLLDYYNRELAYLREMGAEFATRYPKVAGRLGMHGIDVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPSYLSPTPSMAIAQLTPDSRKGDITQGFRVPRGTMMESQNLKKTGVTCSYTTAHDVVLHP
LRISEVTLGGVPGDLPSGELKLGGLGAASALRIRISCEGISSLSQLSVDDLMLFLSGPDIQALKLLELLM
QHRVGIVLQSAEQRPQRQVLTDEALQQEGFAPEQALLPDDLRNFDGYRLLQEYFAFPARFQFISLSQLGP
FLRRCDSATAFDIIILLDKADSALESVVDHSHLALHCTPVINLFPKTAERLKVSDSQHEYHLVVDNIRPL
DYEVHSVQRLFATVEGQREEQVFRPFWSTFSGDQGDYGAYFSLRREQRTLSEQAQRYGTRTGYIGSEVFL
SLVDEHHAPWRDDVRYLSAEVMCTSRDLPLMLQQDQGNFVMPDSIPVSELKLCKGPTPPRPALAEGLSAW
RLISHLQMNYLSLMDSSDGEGAAALRQLLSLYANLAEAPVARQIDGIRHCTLSAVNRRVPEPGPVVFARG
VSITLEVDEQAFSGASPWLFGSVLERVCGRLVALNSFTEFTLNSQQRGEVGYWPPRMGRKALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1092795-1094666 Pantoea vagans C9-1 chromosome, complete genome
ATGGACAGCAATCTGCTCGACTATTACAACCGTGAACTGGCTTACCTGCGCGAGATGGGGGCGGAGTTCG
CGACGCGTTACCCGAAAGTGGCGGGACGTCTTGGCATGCATGGCATCGACGTGGCGGACCCCTATGTCGA
GCGGCTGATGGAGGGATTCGCCTTCCTGACGTCGCGCGTGCAGCTGAAGATGGATGCGGAGTTTCCGCGC
TTCTCGCAGCGATTGCTGGAGATGATTGCGCCATCCTATCTCTCGCCAACGCCGTCAATGGCGATCGCGC
AGCTCACGCCGGACAGCCGCAAGGGTGACATCACCCAGGGCTTTCGCGTGCCGCGCGGCACCATGATGGA
GAGCCAGAACCTGAAAAAAACCGGGGTGACCTGCAGCTACACCACCGCACATGATGTGGTGCTGCATCCG
CTGCGGATCAGCGAAGTCACTCTCGGCGGCGTGCCCGGCGATCTGCCCTCTGGCGAGCTGAAACTGGGTG
GTCTGGGCGCGGCCAGTGCGCTGCGCATCCGCATCAGCTGCGAAGGGATCTCCTCACTGAGTCAGCTCAG
TGTGGATGACCTGATGCTATTCCTCAGCGGCCCCGATATTCAGGCGCTGAAGCTGCTGGAGCTGCTGATG
CAGCACCGGGTCGGCATCGTGCTGCAGTCCGCAGAGCAGCGGCCACAGCGTCAGGTGCTGACGGATGAGG
CCCTGCAGCAGGAGGGCTTTGCACCAGAGCAGGCGCTACTGCCGGACGATCTGCGCAATTTCGACGGTTA
TCGTCTGTTGCAGGAGTATTTTGCGTTTCCGGCGCGCTTCCAGTTTATCAGCCTGAGTCAGCTCGGCCCG
TTCCTGCGTCGCTGCGACAGCGCTACGGCATTCGACATCATTATCCTGCTCGACAAAGCGGACAGCGCGC
TGGAAAGCGTGGTCGATCATAGCCATCTGGCATTGCACTGCACGCCGGTCATCAACCTGTTCCCGAAAAC
CGCCGAGCGCCTGAAGGTCAGCGACAGCCAGCATGAATATCATCTGGTGGTGGATAACATCCGGCCGCTG
GATTATGAGGTGCATTCTGTACAGCGGCTGTTCGCCACCGTAGAAGGCCAGCGGGAAGAGCAGGTTTTCC
GTCCGTTCTGGAGCACCTTCAGCGGTGACCAGGGTGATTACGGTGCTTACTTCTCGCTGCGCCGCGAACA
GCGCACCCTGTCAGAACAGGCGCAGCGCTACGGCACGCGCACCGGCTATATTGGTTCCGAAGTCTTTCTC
TCGCTGGTGGATGAGCATCACGCGCCGTGGCGTGATGACGTGCGCTATCTCTCCGCCGAGGTGATGTGTA
CCAGCCGCGATCTGCCGCTGATGCTGCAGCAGGATCAGGGCAACTTCGTAATGCCGGATTCTATTCCGGT
GTCGGAGCTGAAGCTGTGCAAAGGGCCGACGCCACCGCGTCCGGCGCTGGCCGAAGGCCTTTCTGCGTGG
CGGCTGATCAGCCATCTGCAGATGAACTACCTCAGCCTGATGGACAGCAGCGACGGGGAAGGTGCTGCGG
CGCTGCGCCAGCTGCTGAGCCTCTACGCCAACCTGGCGGAAGCGCCGGTTGCCCGCCAGATTGACGGCAT
CCGCCACTGTACGCTCAGCGCGGTCAACCGCCGCGTGCCGGAACCGGGGCCGGTAGTGTTTGCGCGCGGC
GTCAGCATCACGCTGGAGGTGGATGAGCAGGCGTTTTCGGGTGCCAGTCCGTGGCTGTTCGGCAGCGTGC
TGGAGCGGGTCTGTGGCCGCCTCGTAGCGCTCAACAGCTTCACGGAGTTCACCCTGAACAGCCAGCAGCG
CGGCGAAGTGGGCTACTGGCCACCGCGCATGGGCCGGAAAGCGCTGATATGA