SecReT6
Protein ID: 308186552
SecReT6 ID411
T6SS typei3
Gene symbol-
Locus tagPvag_1041
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1094525..1095709 [+]
Producttype VI secretion system, core protein
NoteTssG
UniProt IDE1SAF9
KEGG IDpva:Pvag_1041
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.10E-109, Aligned region: 71..375
Protein Sequence: 394 a.a.     [Download]
>gi|308186552|ref|YP_003930683.1| unnamed protein product [Pantoea vagans C9-1]
MAVRQRAGAGLWPPRSAQQLHGVHPEQPAARRSGLLATAHGPESADMSGEKVITLPRLTRLPDDFWQKVM
AAPWRYDLFQLLRRLDAQGGQRYPLGRAPLPKFESVRIGQTPSLAFAPATVASATPREESGRHELSIYSF
GLFGPNGPLPTHLTEYVHERIVHHQDHSLSAFADLFHHRATLLFYRAWADAQPTVSLDRPDDSRFLNYLA
CLAGIGLPAQQQASSLSLHARLMLVGHLSRHGHDAEGLVRILRHYFGVPVRLTQNLPHWLTLDSRDQARL
GAGRHMPRLGASAFLGVAVRDVQHRFRLHLGPLSAAQYARFLPDAPGAQEVRDWVRHYLGIEMQWDLSLI
LAADEVQGVALGGAARLGYTSWLGQMPQPQDREDFMFEVEAASR
 
Nucleotide Sequence: 1185 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1094525-1095709 Pantoea vagans C9-1 chromosome, complete genome
GTGGCTGTTCGGCAGCGTGCTGGAGCGGGTCTGTGGCCGCCTCGTAGCGCTCAACAGCTTCACGGAGTTC
ACCCTGAACAGCCAGCAGCGCGGCGAAGTGGGCTACTGGCCACCGCGCATGGGCCGGAAAGCGCTGATAT
GAGTGGCGAAAAAGTCATTACGCTGCCGCGGCTGACCCGACTGCCGGATGATTTCTGGCAAAAAGTGATG
GCCGCGCCGTGGCGCTACGATCTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGGACAGCGCTATC
CGCTGGGCCGTGCGCCGCTGCCGAAGTTCGAATCGGTGCGCATCGGTCAGACGCCGTCACTGGCGTTTGC
GCCCGCCACCGTCGCCAGCGCCACGCCACGTGAAGAGTCCGGACGGCATGAGCTGTCGATCTACAGCTTT
GGCCTGTTTGGCCCCAACGGGCCGCTGCCGACCCATCTGACTGAATATGTGCATGAACGCATCGTGCATC
ATCAGGATCACAGCCTGTCGGCGTTTGCTGACCTGTTCCATCACCGCGCCACGCTGCTGTTTTATCGCGC
CTGGGCGGATGCGCAGCCGACCGTATCGCTGGATCGCCCCGACGACAGCCGCTTTCTGAACTATCTCGCC
TGCCTGGCGGGCATCGGTTTACCGGCCCAGCAGCAGGCCAGTTCGCTGAGTCTTCATGCCCGCCTGATGC
TGGTGGGTCATCTCAGCCGTCACGGTCACGATGCCGAAGGGCTGGTGCGTATCCTGCGCCACTACTTTGG
CGTGCCGGTCCGGCTGACGCAGAACCTGCCGCACTGGCTGACGCTGGACAGCCGCGATCAGGCCCGGCTC
GGCGCGGGACGCCACATGCCCCGGCTGGGTGCCTCTGCTTTTCTCGGGGTGGCGGTGCGTGACGTGCAGC
ACCGTTTTCGCCTGCACCTGGGCCCGCTCAGCGCCGCGCAGTATGCCCGTTTTCTGCCGGATGCTCCCGG
CGCGCAGGAAGTGCGCGACTGGGTGCGTCACTACCTTGGCATCGAAATGCAGTGGGATCTCAGCCTGATC
CTGGCCGCTGACGAAGTGCAGGGTGTGGCGCTGGGCGGCGCTGCCCGGCTTGGTTACACCAGCTGGCTGG
GGCAGATGCCGCAGCCGCAGGATCGAGAAGATTTTATGTTTGAGGTTGAGGCAGCTTCGCGCTAG