SecReT6
Protein ID: 308186553
SecReT6 ID411
T6SS typei3
Gene symbolclpV
Locus tagPvag_1042
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1095764..1098373 [+]
Producttype VI secretion system, core protein ATPase
NoteTssH
UniProt IDE1SAG0
KEGG IDpva:Pvag_1042
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 222..241
AAA_2 [PF07724], Evalue: 1.90E-40, Aligned region: 601..765
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 224..356
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 606..690
ClpB_D2-small [PF10431], Evalue: 2.30E-15, Aligned region: 773..848
AAA_5 [PF07728], Evalue: 1.80E-11, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 1.80E-11, Aligned region: 605..725
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 63..90
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 224..304
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 602..629
AAA_22 [PF13401], Evalue: 1.00E-08, Aligned region: 667..691
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 33..81
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 125..182
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 201..245
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 370..391
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 597..650
AAA_16 [PF13191], Evalue: 8.10E-08, Aligned region: 670..692
Sigma54_activat [PF00158], Evalue: 4.70E-07, Aligned region: 218..238
Sigma54_activat [PF00158], Evalue: 4.70E-07, Aligned region: 295..305
Sigma54_activat [PF00158], Evalue: 4.70E-07, Aligned region: 604..721
AAA_19 [PF13245], Evalue: 5.10E-06, Aligned region: 223..248
AAA_19 [PF13245], Evalue: 5.10E-06, Aligned region: 601..627
AAA_25 [PF13481], Evalue: 6.70E-06, Aligned region: 223..248
AAA_25 [PF13481], Evalue: 6.70E-06, Aligned region: 276..321
AAA_25 [PF13481], Evalue: 6.70E-06, Aligned region: 589..630
AAA_18 [PF13238], Evalue: 1.00E-05, Aligned region: 224..244
AAA_18 [PF13238], Evalue: 1.00E-05, Aligned region: 607..634
AAA_18 [PF13238], Evalue: 1.00E-05, Aligned region: 797..857
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 210..243
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 605..626
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 715..737
AAA_14 [PF13173], Evalue: 2.50E-05, Aligned region: 225..304
AAA_14 [PF13173], Evalue: 2.50E-05, Aligned region: 330..389
AAA_14 [PF13173], Evalue: 2.50E-05, Aligned region: 604..715
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 224..251
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 280..326
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 377..426
NACHT [PF05729], Evalue: 3.30E-05, Aligned region: 606..632
AAA_17 [PF13207], Evalue: 4.00E-05, Aligned region: 224..244
AAA_17 [PF13207], Evalue: 4.00E-05, Aligned region: 605..641
Clp_N [PF02861], Evalue: 4.30E-05, Aligned region: 28..75
Clp_N [PF02861], Evalue: 4.30E-05, Aligned region: 116..123
Clp_N [PF02861], Evalue: 4.30E-05, Aligned region: 311..321
Zeta_toxin [PF06414], Evalue: 7.80E-05, Aligned region: 223..244
Zeta_toxin [PF06414], Evalue: 7.80E-05, Aligned region: 600..645
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 216..240
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 601..630
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 203..238
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 277..307
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 354..398
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 601..645
T2SE [PF00437], Evalue: 0.0024, Aligned region: 202..241
T2SE [PF00437], Evalue: 0.0024, Aligned region: 589..682
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 606..627
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 703..724
DUF815 [PF05673], Evalue: 0.0048, Aligned region: 216..299
DUF815 [PF05673], Evalue: 0.0048, Aligned region: 599..646
UPF0079 [PF02367], Evalue: 0.0075, Aligned region: 224..244
UPF0079 [PF02367], Evalue: 0.0075, Aligned region: 597..633
SRP54 [PF00448], Evalue: 0.0089, Aligned region: 223..244
SRP54 [PF00448], Evalue: 0.0089, Aligned region: 604..637
Protein Sequence: 869 a.a.     [Download]
>gi|308186553|ref|YP_003930684.1| clpV gene product [Pantoea vagans C9-1]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQDGDLQQVITHFSLDEKALTQD
IVAALDRLPRGASAVSDLSEHIDSAVERAWVYASLKYGATRIRGGHLLIGMLKTFNLASVLKGISGQFSR
VNADALLEQFDTLLSNSKEAQQALIAPVDAAGAPPAASGSTLEQYGQDLTARARNGRIDPVTGRDDEIRQ
MVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPAPLRDVQLWLLDIGLLQAGAGMKGEFEARL
QALINEVQSSPTPIVLFVDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPAL
TRRFQTVQVQEPDEAKAILMLRSTVSALEKHHRVLLLDDAVSAAVKLSHRYIPARQLPDKAVALLDTACA
RVAVSQGAQPAALEDCLHRLAALEIEAEIIEREIKVGLGDVTRQQAIAAERTALEAERDALQQRWLQERE
LVETLIALRARCVTEEDAALREQRDATQQQLTALQGDTPLLFAAVDAGVVAAVVSDWTGIPLGRMVKNEI
DAVLNLADTLNQRVIGQRHGLELIAKRVRTTRARLDNPNKPAGVFMLCGPSGVGKTETALALAESLYGGE
QNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDK
GWMEDGEGRHIDFRNTIIILTSNVGTQLISAMCADPELMPDPDALSTALRKPLLEVFPPALLGRLLVVPY
YPLSDDMLAEIVRLQLARIVRRLADNHGIDAQIDESVISQIVQRCTEVESGGRMVDAILTNTLLPQMSQI
LLSAHARDERYRRVEVRCEQGEFVCQFAV
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1095764-1098373 Pantoea vagans C9-1 chromosome, complete genome
ATGTCAGAAATCAGCCGTGCCGTGCTATTCGGCAAACTGGATACGCTGTTATTTACCTCGCTGGAAAGCG
CCACCGCCTTTTGCAAACTGCGCGGCAATCCCTATGTTGAACTGGTGCACTGGCTGCATCAGCTGATGCA
GCAGCAGGATGGCGACTTACAGCAGGTCATCACACATTTTTCACTGGATGAAAAGGCCCTGACTCAGGAC
ATCGTTGCCGCGCTGGATCGCCTGCCGCGCGGTGCCAGTGCGGTCTCCGACCTCTCTGAGCATATCGACA
GCGCCGTGGAGCGGGCATGGGTTTACGCCTCGCTGAAATATGGCGCGACCCGCATTCGCGGTGGCCATCT
GCTGATCGGCATGCTGAAAACTTTCAACCTGGCCAGCGTACTGAAAGGCATCTCCGGCCAGTTCAGTCGC
GTCAACGCCGATGCGCTGCTGGAGCAGTTCGACACGCTGCTCAGCAACAGCAAAGAAGCGCAGCAGGCGC
TGATCGCACCGGTGGATGCCGCTGGCGCACCGCCTGCGGCCAGCGGCAGCACGCTGGAGCAGTACGGGCA
GGACCTGACTGCGCGCGCACGTAACGGCCGCATCGATCCGGTGACCGGCCGTGACGATGAGATCCGCCAG
ATGGTGGATATTCTGATGCGTCGTCGTCAGAACAACCCGCTGCTGACCGGCGAAGCAGGTGTCGGCAAAA
CCGCGGTGGTCGAAGGTCTCGCGCTGCGTATCGCGGCGGGCGATGTGCCTGCGCCGCTGCGCGATGTGCA
GCTCTGGCTGCTGGATATCGGCCTGCTGCAGGCGGGTGCCGGGATGAAAGGGGAGTTCGAAGCACGGCTG
CAGGCGCTGATCAATGAGGTGCAGTCCAGCCCGACGCCGATTGTGCTATTTGTGGATGAGATCCACACCC
TGGTCGGCGCGGGAGGTCAGCAGGGCACCGGCGATGCCGCCAACCTGCTGAAACCGGCGCTGGCGCGCGG
CCAGCTGCGCACCATCGGCGCGACTACCTGGGCCGAATATAAAAAGTACATCGAGAAAGACCCGGCGCTG
ACCCGTCGCTTCCAGACCGTGCAGGTGCAGGAGCCGGATGAAGCCAAAGCGATTCTGATGCTGCGCAGCA
CCGTCAGCGCGCTGGAGAAACACCACCGGGTGCTGCTGCTGGATGATGCGGTCAGTGCGGCGGTGAAACT
GTCGCATCGCTACATTCCGGCGCGTCAGTTGCCGGACAAAGCGGTGGCGCTGCTGGATACCGCCTGCGCC
CGCGTGGCGGTCAGTCAGGGCGCACAGCCTGCGGCGCTGGAGGATTGCCTGCACCGTCTGGCCGCGCTGG
AGATTGAAGCGGAGATCATTGAACGCGAAATTAAGGTCGGCCTCGGTGACGTCACCCGCCAGCAGGCGAT
TGCCGCAGAGCGCACTGCCCTGGAAGCTGAACGCGATGCGCTGCAACAGCGCTGGCTGCAGGAGCGCGAA
CTGGTCGAGACCCTGATTGCGCTGCGTGCCCGCTGTGTTACCGAAGAGGATGCGGCGCTGCGTGAACAGC
GTGATGCAACGCAGCAGCAACTCACTGCGCTGCAGGGCGACACGCCGCTACTGTTTGCCGCCGTCGATGC
GGGCGTGGTAGCGGCCGTGGTGTCGGACTGGACCGGTATTCCGCTGGGCCGGATGGTGAAGAATGAGATC
GACGCCGTCCTGAATCTGGCTGACACCCTGAACCAGCGCGTCATCGGTCAGCGTCACGGTCTGGAGCTGA
TCGCGAAGCGGGTTCGCACCACACGCGCGCGCCTCGATAACCCCAACAAACCCGCAGGCGTCTTTATGCT
GTGCGGTCCGTCCGGTGTAGGGAAAACCGAGACCGCACTGGCGCTGGCCGAGTCACTGTATGGCGGTGAG
CAGAATATCATTACCATCAACATGAGCGAGTTTCAGGAAGCGCACACCGTCTCGACGCTGAAAGGCGCAC
CGCCGGGCTACGTCGGTTACGGCGAGGGCGGCGTGCTGACCGAAGCCGTTCGCCGTCGTCCCTATAGCGT
GGTGCTGCTGGATGAGATTGAGAAAGCCCATCCGGATGTGCATGAGCTGTTCTTCCAGGTGTTCGACAAA
GGCTGGATGGAGGATGGCGAAGGCCGCCACATCGATTTCCGCAACACCATCATTATTCTGACCTCGAACG
TCGGCACGCAGTTGATCAGCGCGATGTGCGCCGATCCTGAACTGATGCCGGATCCCGATGCCCTGAGTAC
CGCACTGCGTAAGCCGCTGCTGGAGGTATTCCCGCCTGCGCTGCTGGGCCGTCTGCTGGTGGTGCCCTAT
TACCCGCTCAGCGATGACATGCTGGCGGAGATCGTGCGGCTGCAGCTGGCGCGCATTGTGCGCCGTCTGG
CCGACAACCACGGCATTGACGCGCAGATCGACGAGTCGGTGATCAGCCAGATCGTGCAGCGCTGCACCGA
GGTGGAGTCGGGCGGTCGCATGGTCGATGCCATCCTCACCAACACGCTGTTGCCGCAGATGAGCCAGATA
CTGCTGAGCGCCCACGCCCGCGATGAACGCTATCGCCGCGTTGAGGTGCGTTGTGAGCAGGGCGAATTTG
TCTGCCAGTTCGCTGTTTAA