SecReT6
Protein ID: 308186555
SecReT6 ID411
T6SS typei3
Gene symbolvgrS
Locus tagPvag_1044
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1099920..1102136 [+]
Producttype VI secretion system, effector protein vgrS
NoteTssI
UniProt IDE1SAG2
KEGG IDpva:Pvag_1044
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-76, Aligned region: 22..330
Phage_base_V [PF04717], Evalue: 2.70E-24, Aligned region: 130..143
Phage_base_V [PF04717], Evalue: 2.70E-24, Aligned region: 368..461
Protein Sequence: 738 a.a.     [Download]
>gi|308186555|ref|YP_003930686.1| vgrS gene product [Pantoea vagans C9-1]
MFSRITAQLPADGLLFHTLTGTETLSRPFVLTAELLATDARIDRHALLGKPVTFSLPTDGLMSALSPRYL
NGKITRVAVRSQELSGTRYAVYQLTVEPDLWPMRRDRNLRIFQSQTVPQIVQTLLKEYAVNVETRLAGNY
RVWEYCVQYQESSLDFISRLMELEGIYYFFRHEADKHTLVLCDAPDQHQAFPGYETIAYHVTQSGGVVTE
EGISQWSLAESVTPGIYSTDDYDFRKPNAWMLQARQNPASPVPGSVDVYDWPGHFVDHSHGESYARIRQE
VWQAEHHSVSGSGTATGIAPGFTFAIINAPHFSDNGEYLVTSATYDFAENSYASGDTGDSRHNISFTVLP
SSVTYRTPPETPWPKTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTADTANALRFED
KAGEEHLWIQAQKNMDTHVKNDASHSVANNHSHYAGGNELYRVETNRVHGVKGGEERLTGKGKLDAVVDT
YVVGSGTKLRLECGESAIELNANGQINIVGKGFNIFVQGDGHITTSGGKLNLNTDGAKPGTSAPGSSHKQ
NISQAVDNLFPPKQKGQAASAAPKAGAAPAKGAAAPLKQNTNAGDPKKLDDSVVRSIMKSEGAGGEQGVY
RKCMVSEKDLGLHIKISLPPGNSMDRVVMKNSQWFQNI
 
Nucleotide Sequence: 2217 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1099920-1102136 Pantoea vagans C9-1 chromosome, complete genome
ATGTTCTCACGCATTACTGCACAGCTGCCGGCGGACGGCCTGCTGTTCCACACGCTCACGGGCACCGAGA
CGCTGTCCCGTCCGTTTGTGCTCACTGCCGAACTGCTGGCCACCGACGCGCGCATCGACCGTCACGCCCT
GCTGGGCAAGCCGGTCACCTTTTCGCTGCCGACCGATGGCCTGATGAGCGCGCTGAGTCCGCGCTACCTC
AACGGGAAAATCACCCGGGTGGCGGTGCGCAGCCAGGAGCTGAGCGGCACCCGCTACGCGGTCTACCAGC
TGACGGTCGAGCCGGACCTGTGGCCGATGCGGCGCGACCGCAACCTGCGCATCTTCCAGAGCCAGACGGT
GCCGCAGATTGTGCAGACGCTGCTGAAGGAGTACGCGGTCAACGTTGAGACGCGCCTGGCGGGTAACTAC
CGGGTGTGGGAGTACTGCGTGCAGTATCAGGAGAGCAGCCTGGACTTTATCAGCCGCCTGATGGAGCTGG
AGGGGATTTACTACTTCTTCCGCCACGAGGCGGACAAACATACGCTGGTGCTGTGCGACGCGCCGGACCA
GCATCAGGCGTTTCCGGGCTATGAGACCATCGCCTATCACGTCACCCAGTCCGGCGGCGTGGTCACGGAA
GAGGGCATCAGTCAGTGGTCGCTGGCGGAGAGCGTGACGCCGGGCATCTACAGCACCGACGACTACGACT
TCCGCAAGCCGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGCGTCGCCGGTGCCGGGCTCGGTGGA
CGTCTACGACTGGCCGGGTCACTTTGTCGACCACAGCCACGGCGAGTCTTACGCGCGCATCCGTCAGGAG
GTGTGGCAGGCCGAGCACCACAGCGTCAGCGGGTCGGGCACGGCCACCGGCATCGCCCCGGGCTTTACCT
TCGCCATCATCAACGCGCCGCACTTCAGCGACAACGGCGAGTATCTGGTGACCTCGGCGACCTATGACTT
TGCCGAGAACTCCTACGCCAGCGGCGACACCGGCGACAGCCGCCACAACATCAGCTTCACGGTGCTGCCG
TCGTCGGTGACGTACCGCACGCCGCCGGAGACGCCGTGGCCGAAAACGCACGGCCCGCAGACCGCGAAGG
TGGTCGGGCCGAAAGGCGAGTCGATCTGGACCGACCGCTACGGCCGGGTGAAGGTGAAGTTTCACTGGGA
CCGGCTGGCGAAGGGCGACGACACCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCTGGTCAGGGG
TTCGGCGGGGTGCAGATCCCGCGAGTCAACGATGAAGTGGTCGTGGACTTTATTAACGGCGACCCGGATC
GTCCGCTGATCATCGGCCGCGTGTATAACGAGGCGAGTATGCCGCCGTGGGCGCTGCCAGCGGCAGCGAC
GCAGATGGGTTTTCTGAGCCGGTCGAAGGATGGCACGGCGGATACCGCGAACGCGCTGAGGTTTGAGGAT
AAGGCGGGTGAGGAACACCTGTGGATTCAGGCGCAGAAGAACATGGATACGCATGTTAAAAATGACGCCA
GCCATTCAGTTGCCAACAATCACAGCCATTACGCGGGCGGCAATGAGCTCTACCGTGTCGAAACTAACCG
CGTCCACGGAGTGAAAGGGGGCGAAGAGCGGCTGACCGGTAAGGGCAAACTCGATGCGGTAGTCGATACC
TATGTTGTAGGGTCGGGCACCAAACTTCGCCTTGAATGCGGAGAGAGTGCTATCGAACTCAATGCGAATG
GTCAGATAAATATAGTCGGTAAAGGATTCAATATTTTCGTGCAGGGCGATGGTCATATCACCACCTCTGG
CGGCAAACTGAACCTGAACACGGATGGTGCGAAACCGGGCACGAGTGCTCCGGGATCCAGTCATAAACAG
AACATCAGTCAGGCCGTAGATAACCTGTTCCCGCCGAAGCAGAAAGGGCAGGCTGCATCCGCTGCACCAA
AGGCTGGGGCGGCCCCGGCGAAAGGTGCGGCTGCGCCGTTAAAACAAAATACAAATGCGGGTGATCCGAA
GAAACTTGATGATAGCGTCGTCCGGTCAATTATGAAGTCAGAAGGTGCGGGTGGTGAACAGGGGGTGTAC
CGGAAATGTATGGTTTCAGAAAAGGATTTGGGCCTGCATATAAAGATATCGCTGCCGCCAGGAAACAGTA
TGGACAGGGTAGTGATGAAGAATTCGCAGTGGTTTCAAAATATATGA