SecReT6
Protein ID: 310819078
SecReT6 ID500
T6SS typei1
Gene symbol-
Locus tagSTAUR_1805
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2237225..2237845 [+]
Productintracellular growth locus subunit a
NoteTssB
UniProt IDQ09CF9
KEGG IDsur:STAUR_1805
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.00E-42, Aligned region: 6..158
Cohesin_load [PF10345], Evalue: 0.0077, Aligned region: 101..167
Protein Sequence: 206 a.a.     [Download]
>gi|310819078|ref|YP_003951436.1| intracellular growth locus subunit a [Stigmatella aurantiaca DW4/3-1]
MPIQDSLPKSRITLTYRTNLSGKEEDVKLPFRVVVLGDFSSGSSTDRQVDLEERKLRSVTGSNINELMKD
MGMSLSFEVDDKLSADGNGRMAVNLPIDRMKSFHPDEIVHHVPKLKALLLLRKLLLEMQADIDNRKDLRR
KLYELFSNKAELQKLLESDQLKSYASMRLPATAKPQAAQAPQAAAAPAQAALVADTVPAVAPAKAT
 
Nucleotide Sequence: 621 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2237225-2237845 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
GTGCCGATTCAGGACAGTTTGCCCAAGTCTCGTATTACCCTCACCTATCGCACCAACCTCAGTGGGAAAG
AGGAGGACGTCAAGCTTCCCTTCCGTGTCGTGGTGCTGGGCGACTTCTCGAGCGGGAGTTCCACGGATCG
CCAGGTAGACCTGGAAGAGCGCAAGCTGCGCTCGGTCACGGGCTCCAACATCAACGAGCTGATGAAGGAC
ATGGGCATGTCCCTCTCGTTCGAGGTGGATGACAAGCTTAGCGCCGATGGCAATGGGCGGATGGCAGTCA
ATCTGCCCATCGACCGGATGAAGTCTTTCCACCCGGATGAGATTGTCCACCACGTGCCCAAGCTCAAGGC
GCTGCTGCTTTTGCGCAAGCTGTTGCTGGAAATGCAGGCGGACATCGACAACCGCAAGGATTTGCGGCGC
AAGCTCTACGAGTTGTTCTCCAACAAGGCAGAGTTGCAGAAGTTGCTGGAGAGCGATCAGCTCAAGAGCT
ACGCGAGCATGCGTCTGCCCGCCACTGCGAAGCCGCAAGCCGCGCAAGCCCCGCAGGCGGCTGCCGCGCC
GGCTCAGGCCGCGCTCGTCGCCGACACCGTTCCCGCTGTGGCTCCCGCCAAGGCCACCTGA