SecReT6
Protein ID: 310819079
SecReT6 ID500
T6SS typei1
Gene symbol-
Locus tagSTAUR_1806
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2237887..2239380 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ09CG0
KEGG IDsur:STAUR_1806
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-160, Aligned region: 76..496
Protein Sequence: 497 a.a.     [Download]
>gi|310819079|ref|YP_003951437.1| hypothetical protein STAUR_1806 [Stigmatella aurantiaca DW4/3-1]
MADNKNYLKELFQVRGLEVPLQAQPMVGTGLVPAAHSDLQMSGDERFMSSLAALLYNVEPIQDEAGEARF
DKGEVMKAIARIDGLIESQMNEILHAEEFQTMEASWRGLEDLVNHTNFQADITIDILDVAKEELSEDFEK
NSSNIFSSALFDKMYIKEYDQFGGKPYGVMLGLYEFSASRADLTWLERMGKVANAAHCPFVSAVSPKFFD
CESIEQLESLKNLDGVLSHPRYSKWMELRDKEEAAYIGLTLPRYVVRLPWDPDRNPCDVLNFKEDAEGDS
KKYLWGNASYLMGRNLVKAFEQSGWCQSIRGPKGGGLVTGLPVDTFTLRGQKMIQAPVEIAIPDYREYEF
ARNGFIPLVHRKGSSEATFFSTQSIKRAKKFKDPKDSENAQLVTNLAYTFSITRLAHYIKSIARDNIGST
ADAGYVQRQLDAWLAGYITTVVNPDDLTLRRFPFKATQVIVESRPGELGWYDCKVSVLPHIQFEGLNVEL
MLESRLG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2237887-2239380 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
ATGGCTGACAATAAGAATTATCTGAAAGAGTTGTTCCAGGTTCGCGGCCTCGAGGTTCCCCTCCAGGCCC
AGCCGATGGTGGGGACCGGTCTGGTGCCCGCCGCCCACAGTGACTTGCAGATGTCGGGGGACGAGCGGTT
CATGTCCTCCCTGGCCGCGTTGCTCTACAACGTCGAGCCCATCCAAGACGAGGCGGGCGAGGCCCGCTTC
GACAAGGGCGAGGTGATGAAGGCCATCGCTCGCATCGATGGCCTCATCGAGTCACAGATGAACGAGATCC
TCCACGCCGAGGAGTTCCAGACGATGGAAGCCTCCTGGCGGGGATTGGAGGACCTCGTCAACCACACCAA
CTTCCAGGCCGACATCACCATCGACATCCTGGATGTCGCGAAGGAAGAGCTGAGCGAGGACTTCGAGAAG
AACTCGAGCAACATCTTCTCCAGCGCGCTGTTCGACAAGATGTACATCAAGGAGTACGACCAGTTCGGCG
GCAAGCCTTATGGGGTGATGCTGGGGCTGTATGAGTTCTCCGCCTCGCGCGCGGATCTCACCTGGCTGGA
GCGCATGGGCAAGGTGGCCAATGCCGCGCACTGCCCCTTCGTCTCCGCGGTCAGCCCCAAGTTCTTCGAT
TGTGAGAGCATCGAGCAGCTCGAGTCGCTCAAGAACCTGGATGGCGTGCTGAGCCACCCGCGCTACAGCA
AGTGGATGGAGCTGCGCGACAAGGAAGAGGCGGCCTACATTGGCTTGACGCTGCCGCGCTACGTGGTGCG
GCTGCCGTGGGATCCGGACCGCAACCCCTGCGACGTGCTGAACTTCAAGGAGGACGCGGAGGGGGACTCG
AAGAAATACCTGTGGGGCAATGCGTCCTACCTGATGGGCCGCAACCTGGTGAAGGCCTTCGAGCAGTCGG
GGTGGTGCCAGTCGATCCGTGGCCCCAAGGGCGGCGGGCTCGTCACCGGGCTGCCGGTGGATACCTTCAC
CCTGCGCGGGCAGAAGATGATCCAGGCGCCGGTGGAGATCGCCATCCCGGATTATCGCGAGTACGAGTTC
GCCCGCAATGGCTTCATTCCGCTGGTGCACCGCAAGGGCTCCAGCGAGGCGACCTTCTTCAGCACCCAGT
CCATCAAGCGGGCCAAGAAGTTCAAGGACCCGAAGGATTCGGAAAACGCGCAGCTGGTCACCAACCTGGC
GTACACGTTCTCCATCACCCGGCTGGCGCACTACATCAAGAGCATCGCGCGCGATAACATCGGGAGCACG
GCCGACGCGGGCTATGTCCAGCGGCAGCTCGACGCCTGGCTCGCCGGATACATCACCACGGTGGTGAATC
CGGATGACCTGACGTTGCGGCGCTTCCCTTTCAAGGCCACTCAGGTCATTGTGGAGTCCCGGCCCGGTGA
GCTGGGCTGGTACGACTGCAAGGTGTCGGTCCTGCCGCACATCCAGTTCGAAGGCCTCAATGTGGAGTTG
ATGCTGGAGTCCCGCCTGGGGTAG