SecReT6
Protein ID: 310819081
SecReT6 ID500
T6SS typei1
Gene symbol-
Locus tagSTAUR_1808
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2240030..2241283 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ09CG2
KEGG IDsur:STAUR_1808
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-56, Aligned region: 21..414
Protein Sequence: 417 a.a.     [Download]
>gi|310819081|ref|YP_003951439.1| hypothetical protein STAUR_1808 [Stigmatella aurantiaca DW4/3-1]
MQRHKLARVRWQVGQTLLPEHFRAQDEALSSETRLHAELSGLPQVGIASFAWSEALLAEGSLAVSTLTAV
LPGGFLVDVPGNAVLPPLSLEATGRAEVTVHLHLLDETRGAEGVPLYADEPPSVQRYLSRLQLSSEQSVD
RALSSMELVAFSKNLEGAWRPAARKVPPLLLVGANPFLNELLSELDLLLEKAHGQLRTLLLDSYQRSERL
ASARRTLLEVRRLQSLRVDMRGGICPHPYAFFDALRRFYFEVCCYLELEPDGALPAYRHDELGAGLWGWM
DLLNRAFRPEDTRLTYKPFESKEGQFILTPLPTLDEGVQSELYLLVRSEDPSRPPSMEGVKVASPSRLSA
VRRLALRGIPFQHVPHPAFPHAFGPEISWYKLSLGEEWQYALRDNGMAFYATPALQGTQVFLFWRRA
 
Nucleotide Sequence: 1254 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2240030-2241283 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
ATGCAGCGCCACAAGCTCGCGCGGGTCCGCTGGCAGGTTGGCCAAACGCTCCTTCCCGAGCACTTTCGCG
CCCAGGACGAGGCGCTTTCGTCCGAGACGCGGCTGCATGCCGAGCTGTCCGGGTTGCCTCAGGTCGGTAT
CGCCTCCTTCGCTTGGAGCGAGGCGTTGCTGGCCGAGGGCAGCCTCGCCGTGTCTACCCTGACCGCCGTC
CTGCCAGGAGGTTTCCTGGTGGACGTGCCGGGCAATGCCGTCCTTCCACCGCTCTCGCTCGAAGCCACCG
GCCGCGCGGAGGTCACCGTCCACCTCCACCTGCTGGATGAGACGCGCGGCGCGGAAGGGGTGCCGCTCTA
CGCGGATGAGCCGCCCAGCGTGCAGCGGTACTTGAGCCGGTTGCAGCTCTCCAGCGAGCAGTCCGTGGAC
CGGGCCCTCTCGTCGATGGAGCTGGTGGCCTTCTCCAAGAACCTCGAAGGGGCTTGGCGCCCCGCGGCCC
GGAAGGTGCCGCCGCTGTTGCTGGTGGGGGCCAACCCCTTCCTCAATGAGCTCCTGAGCGAGTTGGACCT
GCTGCTGGAGAAGGCCCACGGCCAGCTGCGCACCCTGCTGCTGGACAGCTATCAGCGCAGCGAGCGGCTG
GCGAGCGCCCGGAGAACCCTTCTCGAGGTGCGCCGCCTGCAGTCGCTGCGCGTGGACATGCGCGGCGGCA
TCTGCCCGCATCCCTACGCCTTCTTCGATGCCCTGCGCCGGTTCTACTTCGAGGTGTGTTGCTACCTGGA
GTTGGAGCCGGATGGCGCCTTGCCCGCGTACCGGCACGATGAGCTGGGGGCGGGGTTGTGGGGGTGGATG
GATCTGCTCAACCGCGCCTTCCGGCCCGAGGACACGCGGCTCACCTACAAGCCCTTCGAGAGCAAGGAAG
GGCAGTTCATTCTCACCCCGCTTCCCACGCTGGATGAGGGCGTGCAGAGCGAGCTGTACCTCCTGGTGCG
GAGCGAGGATCCCAGTCGGCCGCCCTCGATGGAGGGGGTGAAGGTGGCGAGCCCGTCCCGCTTGTCCGCG
GTGCGCCGGCTGGCGCTTCGGGGCATCCCCTTCCAGCATGTGCCGCACCCTGCGTTTCCTCATGCCTTCG
GGCCAGAGATCTCCTGGTACAAGTTGTCGCTGGGTGAGGAGTGGCAGTACGCCCTGCGTGACAACGGCAT
GGCCTTCTACGCCACCCCTGCGCTTCAGGGGACCCAGGTGTTTCTCTTCTGGCGCAGGGCGTAA