SecReT6
Protein ID: 310819082
SecReT6 ID500
T6SS typei1
Gene symbol-
Locus tagSTAUR_1809
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2241287..2241679 [+]
Productgpw/gp25 family protein
NoteTssE
UniProt IDQ09CG3
KEGG IDsur:STAUR_1809
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.10E-13, Aligned region: 21..108
Protein Sequence: 130 a.a.     [Download]
>gi|310819082|ref|YP_003951440.1| gpw/gp25 family protein [Stigmatella aurantiaca DW4/3-1]
MARPSFLDKFTSNWQRSEDEGELQRVCQNIEAVLNTKEGYGYFVEGFGLGRYTEKFGTRDLMKTLTQEIL
HSVERHEPRLQEVELTLRGQDSGLWLHFVLTGSLLGSPCTLRILFHTISGQVRVEEDEEG
 
Nucleotide Sequence: 393 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2241287-2241679 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
ATGGCGCGCCCCTCCTTCCTCGACAAGTTCACCAGCAATTGGCAGCGCTCGGAAGACGAGGGCGAGCTGC
AGCGGGTGTGTCAGAACATCGAAGCGGTGCTCAACACCAAGGAGGGCTATGGGTACTTCGTCGAAGGCTT
CGGGCTGGGGCGCTACACGGAGAAGTTCGGCACCCGAGACCTGATGAAGACGCTGACCCAGGAAATCCTG
CACTCGGTGGAGCGCCATGAGCCGCGCCTGCAAGAGGTGGAGCTGACGCTGCGGGGCCAGGACTCCGGGT
TGTGGCTGCACTTCGTCTTGACTGGCTCCTTGCTTGGCTCTCCCTGTACGCTGCGGATCCTCTTTCACAC
CATCAGTGGCCAGGTGCGGGTGGAAGAGGACGAGGAGGGATGA