SecReT6
Protein ID: 310819085
SecReT6 ID500
T6SS typei1
Gene symbolimpG
Locus tagSTAUR_1812
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2243980..2245629 [+]
Producthypothetical protein
NoteTssF
UniProt IDE3FTK2
KEGG IDsur:STAUR_1812
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-31, Aligned region: 12..342
DUF879 [PF05947], Evalue: 1.60E-31, Aligned region: 407..441
Protein Sequence: 549 a.a.     [Download]
>gi|310819085|ref|YP_003951443.1| hypothetical protein STAUR_1812 [Stigmatella aurantiaca DW4/3-1]
MSDSSDRIYQDYLSELDALERFRQRFLESHPHVPLDREDPHVRRLIESMAFFSVQTRLATQHNLRSTWLR
LFSSFFDFLLKPLPSVALVQALPTEKMTETLVLARGTELRLAPAHGGAGSFRTRRNLRVLPISMRGTEVV
RLADGRYRLLLHFESSFPRRDPVGLFSLYVRHLDEYRPSLAVFHALRKHLQQLSVVYDAPANESSQGMPC
EYSFGDAPAELEDAGDFEHPLQRVRAFFQMPEQGLFLHVAVPSHRKEWTRFSLCLDLDKGWTVGRSTHPD
FFQPFVVPVENLKSEPAQPIVADGTRSEYTIRGMTAGRDMQLHAVTGVYVLGRSGRTPMRPAFLPGEGPS
YELEESLDEEMRPRHSLLVRLPEALLEPKKLLVEALWYQPRFVSEATGRLSVSTPGRHVEGLKWQLVGRL
EPHRDSALRNDVAGLTRLLSWKVKSTLERNELAALLNYLGTPAEEPFRRVIPWIRELKATVAPDGALRGS
GLLHVYELLLEPFDASAESLVACFLEQVLLLLEAWNGEASVVLRPTVAGGGAFPLKASS
 
Nucleotide Sequence: 1650 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2243980-2245629 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
GTGAGCGACTCCTCGGACCGGATCTACCAGGACTACCTGAGCGAGTTGGATGCGCTGGAACGCTTCCGGC
AGCGCTTCCTGGAGTCGCACCCCCATGTGCCGCTGGACCGGGAGGATCCGCATGTGCGGCGCCTCATCGA
GTCCATGGCCTTCTTCTCGGTGCAGACCCGCCTGGCCACGCAGCACAACCTGCGCTCGACCTGGCTGCGC
CTGTTTTCCTCCTTCTTCGACTTCTTGCTGAAGCCGCTCCCCTCGGTGGCCCTGGTGCAGGCGCTGCCCA
CGGAGAAGATGACGGAGACGCTGGTGCTCGCCCGGGGGACGGAGCTTCGGCTCGCCCCCGCGCATGGGGG
GGCGGGGAGCTTCCGCACCCGCCGCAACCTGCGCGTCCTGCCCATCTCCATGCGGGGCACGGAAGTGGTG
CGCCTGGCGGATGGCCGCTACCGGTTGCTGCTTCACTTCGAGTCCAGCTTCCCCCGGAGGGATCCGGTGG
GGCTGTTCAGCCTGTACGTGCGCCACCTGGACGAGTACCGGCCCTCGCTGGCCGTGTTTCACGCGTTGCG
CAAGCACCTCCAGCAACTGAGCGTGGTGTATGACGCCCCGGCCAACGAGTCCTCCCAGGGCATGCCGTGC
GAGTACTCCTTCGGAGATGCTCCGGCCGAGCTGGAGGACGCGGGCGATTTCGAGCACCCGCTGCAGCGCG
TGCGCGCCTTTTTCCAGATGCCCGAGCAGGGCCTCTTCCTCCATGTGGCGGTGCCCTCGCACCGCAAGGA
GTGGACTCGCTTCAGCCTGTGCCTGGACCTGGACAAGGGCTGGACGGTGGGGCGCTCGACTCACCCGGAC
TTCTTTCAGCCCTTCGTCGTGCCGGTGGAGAACCTCAAGTCCGAGCCCGCCCAGCCCATCGTCGCCGATG
GCACCCGCTCGGAGTACACCATTCGCGGCATGACCGCCGGCAGGGACATGCAGTTGCATGCCGTCACCGG
TGTGTACGTGCTGGGCCGCTCGGGGCGCACGCCCATGCGGCCGGCTTTCCTGCCGGGAGAGGGGCCGAGC
TACGAGCTGGAGGAGTCGCTCGATGAGGAGATGCGTCCGCGCCACAGCCTGCTGGTGCGCCTGCCCGAGG
CCCTCCTCGAGCCGAAGAAGCTGCTGGTGGAGGCGCTCTGGTACCAGCCCCGGTTCGTTTCCGAGGCCAC
GGGAAGGCTGAGTGTCTCCACGCCGGGGCGGCATGTGGAAGGGCTCAAGTGGCAGCTGGTGGGCCGGCTC
GAGCCGCACCGTGACAGCGCCCTGCGCAACGACGTGGCGGGGCTGACCCGGCTGCTCTCCTGGAAGGTCA
AGTCCACCCTCGAGCGCAATGAGCTCGCCGCGTTGCTGAATTACCTCGGCACCCCCGCCGAGGAGCCCTT
CCGCCGCGTCATTCCCTGGATCCGGGAGCTCAAAGCCACGGTGGCCCCGGATGGCGCCCTGCGCGGCTCG
GGACTGTTGCATGTCTATGAATTGTTGCTGGAGCCGTTCGATGCCAGCGCCGAGTCGTTGGTGGCCTGTT
TCCTGGAGCAGGTGCTGTTGCTGCTGGAGGCATGGAATGGCGAGGCTTCCGTGGTGCTCCGGCCCACGGT
GGCGGGCGGTGGCGCCTTCCCGTTGAAAGCATCCTCATGA