SecReT6
Protein ID: 310819086
SecReT6 ID500
T6SS typei1
Gene symbol-
Locus tagSTAUR_1813
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2245626..2246264 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ09CG8
KEGG IDsur:STAUR_1813
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.40E-20, Aligned region: 47..208
Protein Sequence: 212 a.a.     [Download]
>gi|310819086|ref|YP_003951444.1| hypothetical protein STAUR_1813 [Stigmatella aurantiaca DW4/3-1]
MKLEHWQNILRTHRQVLSLLDQSLPAESAEGEPRTQVRVGLQGLVLLQQQLLGEVAGLRNVLGASYREEE
VDEALRPFVYLLDELVLRRLADSEQSDWPLLQYKLFGLDSGGDRFYEMADEKLVQRAASPLVFELLHFCL
TAGFEGRHAGNAARLREYKERLAARIPKPEAVPAPPPPVAQVPLVHSFPMRYYAASGFVVLALPVLLWWL
SR
 
Nucleotide Sequence: 639 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2245626-2246264 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
ATGAAACTCGAGCATTGGCAGAACATCCTCCGGACCCACCGGCAGGTTCTCTCCTTGTTGGATCAGTCCT
TGCCGGCCGAGTCCGCCGAGGGCGAGCCCCGCACGCAGGTGCGGGTGGGGCTGCAAGGTCTGGTTTTGCT
CCAGCAGCAGCTTTTGGGGGAAGTCGCGGGACTCCGGAACGTGCTGGGAGCCTCTTACCGGGAAGAGGAG
GTGGACGAGGCGCTGCGCCCCTTCGTCTATCTGCTCGACGAGCTGGTGCTGCGCCGGTTGGCGGACAGCG
AGCAGTCAGACTGGCCGTTGCTGCAGTACAAGTTGTTCGGCCTCGATTCGGGCGGAGACCGCTTCTACGA
AATGGCGGATGAAAAGCTGGTGCAGCGCGCCGCCTCGCCGCTGGTTTTCGAACTGCTACATTTCTGTCTC
ACCGCGGGTTTCGAGGGCCGTCACGCGGGGAACGCGGCCCGGTTGCGCGAGTACAAGGAACGCCTGGCGG
CCCGCATCCCGAAGCCCGAGGCGGTGCCTGCTCCCCCGCCCCCCGTCGCGCAGGTGCCCCTCGTTCACTC
CTTTCCCATGCGCTACTACGCGGCGTCCGGTTTCGTGGTGCTGGCCCTCCCAGTGCTACTGTGGTGGCTG
TCGAGATGA