SecReT6
Protein ID: 311108847
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05686
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6106103..6108805 [-]
ProductRhs element Vgr family protein 1
NoteTssI
UniProt IDE3HG82
KEGG IDaxy:AXYL_05686
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-77, Aligned region: 42..357
Phage_GPD [PF05954], Evalue: 2.20E-77, Aligned region: 624..682
DUF2345 [PF10106], Evalue: 1.20E-33, Aligned region: 706..868
T6SS_Vgr [PF13296], Evalue: 4.20E-28, Aligned region: 568..673
Phage_base_V [PF04717], Evalue: 5.10E-20, Aligned region: 416..519
Protein Sequence: 900 a.a.     [Download]
>gi|311108847|ref|YP_003981700.1| Rhs element Vgr family protein 1 [Achromobacter xylosoxidans A8]
MPLDNTGLSRMSIASVDQANRLLDLRTPLGANRLVAETLSATETLSDGAFRLELTALSDDAGIPLSELLG
KPATLRLQTALGRDQPRVWNGYITAAQFQGANGGMARYGLTLEPWLAFLRARRDSFAYQDKTVFEIVDSI
FGDYKDQGGLAPQWRWVVKDRAAYAKRSLTVQYRETDHAFVERLLAEEGLFYWVEHEGGEGEGSHTLIIA
DHNGAFLPGPQASVRFARADVTETEDSIQQWSRRARWQTNAVRMASWDYRSAQARPVAAQVDGGAAKGAM
DLVVNDYPGQYAYEDSAQGERLAHIALAALRVGQDSCEGAGTVRTLAPGQRFELTGHYQQGGSDYVAIAV
RHEARNNFDEDLGRAVREALGESGPEAAEADFYRNTFTCIGIDTEFRKATRDGHGERLHPRPTVYGAQTA
LVVGAEAPVHTDRDHRVKVQFHWQRGKASSSRLEHPSGDENAPAKDELGTWVRVAEPVAGGDWGGNFVPR
VGQEVLVEFLHGDIDRPVVVGALYNGAGAEDASHNQVQGGAANATGNAPAWFAGGADGHAHNVVMSGFKT
QALASSGQGTGGYNQLVHDDTPGQSRLTASTTQAESRLNLGHIKQQRDNERLQDLGHGAELSTREAVALR
GGAGLLISADARKNAKGALLDSEEAGLQIENAMRAAEELAQAATRQKAVLEGDPETLPAQDALKHVLEVI
DAKQDAPEGEPVAAYSEPQLQVSAPSGIGQYTPVDAFLVAGATLAQVAPDVNWVSSANVAMGVAGGAVLF
TLGRKAPGGSPVQGQGLLLHAAGGKLRLHSQDAKMTLSAEKAVTFASAQAGVTVQAAKRVLATAGGAYMR
VEGGGIQLHAPGKVELKAGVHNWVGPESSQANLAFNEASPLCEARVRGAAQRGGAVVPLG
 
Nucleotide Sequence: 2703 bp     [Download]
>ref|NC_014640.1|:c6108805-6106103 Rhs element Vgr family protein 1 [Achromobacter xylosoxidans A8]
ATGCCTTTGGACAACACCGGCCTTTCCCGAATGTCGATCGCGTCGGTCGATCAGGCCAATCGCCTGTTGG
ACCTGCGCACGCCGCTGGGCGCGAACCGGCTCGTGGCGGAAACGCTATCCGCCACGGAAACCCTGTCGGA
CGGCGCGTTCCGGCTCGAACTGACCGCCCTGTCCGACGATGCCGGCATTCCCTTGTCCGAACTGCTGGGA
AAGCCGGCGACCCTGCGCCTGCAGACCGCATTGGGCCGCGACCAGCCGCGCGTCTGGAACGGCTACATCA
CGGCGGCGCAGTTCCAGGGCGCCAACGGTGGTATGGCGCGCTACGGGCTGACGCTGGAGCCCTGGCTCGC
TTTTCTGCGCGCGCGCCGCGACAGCTTTGCCTATCAGGACAAGACGGTCTTTGAAATCGTCGACAGCATC
TTTGGCGACTATAAGGACCAAGGAGGCCTCGCGCCGCAGTGGCGCTGGGTGGTGAAGGACCGCGCCGCGT
ACGCCAAGCGCAGCCTGACCGTGCAGTACCGCGAGACCGACCATGCCTTCGTCGAGCGTCTGCTGGCCGA
AGAGGGCCTGTTCTACTGGGTGGAGCACGAAGGCGGCGAAGGCGAGGGCAGCCACACGCTGATCATCGCC
GACCATAACGGCGCCTTCCTGCCCGGCCCGCAGGCCAGCGTGCGCTTCGCGCGCGCCGATGTCACGGAGA
CCGAGGACAGCATCCAGCAGTGGAGCCGGCGCGCGCGCTGGCAGACCAACGCGGTGCGCATGGCCAGCTG
GGACTACCGCAGCGCCCAGGCCAGACCAGTAGCGGCGCAGGTCGATGGCGGCGCCGCGAAGGGCGCGATG
GATCTGGTCGTCAACGACTATCCCGGCCAGTACGCCTACGAGGACAGCGCGCAGGGCGAACGCCTGGCGC
ATATTGCGCTGGCCGCGCTGCGCGTGGGCCAGGACAGCTGCGAGGGCGCGGGCACCGTGCGCACGCTGGC
GCCAGGCCAGCGCTTCGAACTGACCGGGCACTACCAGCAGGGCGGGTCCGACTACGTGGCGATCGCCGTG
CGGCACGAGGCCCGCAACAATTTCGACGAGGACCTGGGCCGCGCCGTGCGCGAGGCGCTGGGCGAGAGCG
GTCCGGAGGCGGCCGAGGCCGACTTCTACCGCAACACGTTTACCTGCATCGGCATCGATACTGAATTCCG
CAAGGCCACGCGCGACGGACATGGCGAGCGCCTGCATCCCCGGCCCACCGTGTACGGCGCGCAGACCGCG
CTGGTGGTGGGCGCGGAAGCGCCGGTGCATACCGACCGCGATCATCGCGTCAAGGTGCAGTTCCATTGGC
AGCGCGGCAAGGCGTCCAGCAGCCGCCTGGAACATCCCTCGGGCGACGAGAACGCGCCCGCCAAGGATGA
GCTGGGCACCTGGGTGCGCGTCGCGGAGCCCGTGGCAGGCGGCGACTGGGGCGGCAACTTTGTGCCGCGC
GTCGGTCAGGAAGTGCTGGTCGAGTTCCTGCACGGCGACATCGACCGTCCCGTGGTGGTTGGCGCGCTCT
ACAACGGCGCGGGTGCCGAGGACGCGTCGCACAACCAGGTGCAGGGCGGCGCCGCCAACGCCACCGGTAA
CGCGCCCGCCTGGTTCGCCGGCGGCGCCGACGGCCATGCGCACAACGTGGTGATGTCCGGCTTCAAGACG
CAGGCGCTCGCCAGCAGCGGGCAGGGTACTGGCGGCTACAACCAGCTGGTGCACGACGACACGCCGGGAC
AGTCGCGCCTGACGGCTTCGACCACGCAGGCCGAGAGCCGCCTGAACCTGGGACACATCAAGCAGCAGCG
CGACAACGAAAGGCTGCAGGACCTGGGTCACGGCGCGGAACTGTCGACCCGCGAGGCGGTGGCGCTGCGC
GGCGGCGCGGGGCTGCTGATCAGCGCGGACGCGCGCAAGAACGCCAAGGGCGCGCTGCTGGATAGCGAGG
AGGCGGGCCTGCAGATCGAGAACGCGATGCGCGCGGCCGAGGAACTGGCGCAGGCGGCAACGCGGCAGAA
GGCCGTGCTGGAAGGCGATCCGGAAACGCTGCCGGCGCAGGACGCGCTGAAGCACGTGCTGGAGGTGATC
GATGCGAAACAGGACGCGCCCGAAGGCGAGCCCGTCGCGGCCTATAGCGAACCGCAGCTCCAGGTGAGCG
CGCCCAGCGGTATCGGGCAGTACACGCCGGTCGACGCATTTCTCGTGGCCGGCGCGACCCTGGCGCAGGT
GGCGCCGGACGTGAACTGGGTTAGCAGCGCCAACGTTGCGATGGGCGTGGCCGGCGGCGCGGTGCTGTTC
ACACTGGGACGCAAGGCGCCCGGCGGCAGCCCGGTGCAGGGCCAGGGACTGCTGCTGCATGCGGCCGGCG
GCAAGCTGCGCCTGCACAGCCAGGACGCCAAGATGACGCTGTCCGCTGAAAAGGCGGTGACCTTCGCCTC
GGCGCAGGCCGGCGTGACGGTGCAGGCGGCCAAGCGCGTGCTGGCAACGGCGGGTGGCGCCTACATGCGG
GTGGAAGGCGGCGGCATTCAGCTGCATGCGCCGGGCAAGGTCGAATTGAAGGCAGGCGTGCATAACTGGG
TCGGCCCGGAAAGCAGCCAGGCGAATCTGGCCTTCAACGAAGCCAGTCCCTTGTGCGAAGCCCGGGTGCG
CGGCGCGGCCCAGCGGGGCGGCGCCGTGGTGCCGCTGGGCTGA