SecReT6
Protein ID: 311108848
SecReT6 ID412
T6SS typei4b
Gene symbolclpB2
Locus tagAXYL_05687
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6108820..6111519 [-]
Productchaperone protein ClpB
NoteTssH
UniProt IDE3HG83
KEGG IDaxy:AXYL_05687
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-44, Aligned region: 232..308
AAA_2 [PF07724], Evalue: 1.80E-44, Aligned region: 628..797
AAA [PF00004], Evalue: 9.00E-20, Aligned region: 232..345
AAA [PF00004], Evalue: 9.00E-20, Aligned region: 634..718
AAA_5 [PF07728], Evalue: 2.60E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 2.60E-13, Aligned region: 305..362
AAA_5 [PF07728], Evalue: 2.60E-13, Aligned region: 633..752
ClpB_D2-small [PF10431], Evalue: 1.40E-12, Aligned region: 804..878
AAA_16 [PF13191], Evalue: 7.90E-10, Aligned region: 209..249
AAA_16 [PF13191], Evalue: 7.90E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 7.90E-10, Aligned region: 422..507
AAA_16 [PF13191], Evalue: 7.90E-10, Aligned region: 602..655
AAA_16 [PF13191], Evalue: 7.90E-10, Aligned region: 699..722
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 231..318
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 361..448
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 630..654
AAA_22 [PF13401], Evalue: 3.90E-08, Aligned region: 694..727
Clp_N [PF02861], Evalue: 2.40E-07, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.40E-07, Aligned region: 113..130
AAA_29 [PF13555], Evalue: 6.80E-06, Aligned region: 226..249
AAA_29 [PF13555], Evalue: 6.80E-06, Aligned region: 628..658
AAA_29 [PF13555], Evalue: 6.80E-06, Aligned region: 731..761
AAA_29 [PF13555], Evalue: 6.80E-06, Aligned region: 774..788
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 210..247
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 631..750
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 211..245
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 284..381
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 630..673
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 704..726
AAA_17 [PF13207], Evalue: 5.20E-05, Aligned region: 66..106
AAA_17 [PF13207], Evalue: 5.20E-05, Aligned region: 232..281
AAA_17 [PF13207], Evalue: 5.20E-05, Aligned region: 633..669
AAA_19 [PF13245], Evalue: 7.80E-05, Aligned region: 232..255
AAA_19 [PF13245], Evalue: 7.80E-05, Aligned region: 630..655
IstB_IS21 [PF01695], Evalue: 0.00025, Aligned region: 224..254
IstB_IS21 [PF01695], Evalue: 0.00025, Aligned region: 633..651
AAA_23 [PF13476], Evalue: 0.0045, Aligned region: 232..248
AAA_23 [PF13476], Evalue: 0.0045, Aligned region: 470..512
AAA_23 [PF13476], Evalue: 0.0045, Aligned region: 630..664
Protein Sequence: 899 a.a.     [Download]
>gi|311108848|ref|YP_003981701.1| chaperone protein ClpB [Achromobacter xylosoxidans A8]
MATPLKTLIGKLNQTCRQAAERAASLCMAQGHYEVDLEHLFLALLEKPASDFSIVARRSGIESAVLEADL
NAEIRGFKNGNTRTPVFSPHLPRLFEHAWLIASLDTQTTRIRSGHLLLALLTEPDLAQLARRGSRLFESF
RLDELKHDYAALTAGSEEAGQSVALGDSPAGDAGQDGAAAAAGLSKTPALDQYTANLTERAREGKIDPVI
GRDAEIRQMIDILTRRRQNNPILTGEAGVGKTAVVEGLALRIVAGDVPPALAGVALRTLDMGLLQAGASV
KGEFENRLKNVIDEVKQSSTPIILFIDEAHTMIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSEELAASMLRGMAPLMEQHFGVRVLDEAIVAAARLSHRYISGRQLPDKAV
SVLDTACARVALGRSATPALIDDARHRLARLETERAALRREAAAGAAQSARLRELDLEMDATRAALTDAE
ARLAQESELVRQIHALREELEAAGADAAPEPAGKRRSGKAAEPAATPGQAQLAELQQQLRALQGEAPLVP
AFVDAQVIAEIVSAWTGIPLGRMVNDEIRTVLELQPLLAERVIGQDHALHAIAQRVRTARAGLEDPNKPK
GVFLFIGPSGVGKTETALAVADVLYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRR
QPYSVVLLDEIEKAHPDVLELFFQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSAIMQACLNKSVEERP
DPEALQELLTPQLYKAFKPAFLGRMKTIAYYPVDDDALARIIGLKLGRIAQRVQANHRALFEWDEALVEA
VLARCTEVDTGARNVDHILNGTLLPQIAEQVLGRMAQGEAIARIRVTAGKNGDFRYRLA
 
Nucleotide Sequence: 2700 bp     [Download]
>ref|NC_014640.1|:c6111519-6108820 chaperone protein ClpB [Achromobacter xylosoxidans A8]
ATGGCCACACCCTTGAAGACCCTGATTGGAAAGCTCAACCAGACCTGCCGCCAGGCGGCCGAGCGCGCCG
CCAGCCTGTGCATGGCCCAGGGGCACTACGAGGTGGACCTGGAGCACCTGTTCCTGGCGTTGCTGGAAAA
GCCGGCCAGCGATTTCAGCATCGTGGCGCGGCGCAGCGGCATCGAGTCGGCGGTGCTGGAAGCGGACCTG
AACGCGGAAATCCGCGGCTTCAAGAATGGCAACACGCGCACGCCGGTGTTCTCGCCGCATCTGCCGCGGC
TGTTCGAGCATGCCTGGCTGATCGCCTCGCTGGACACGCAGACCACTCGCATCCGTTCCGGCCATCTGCT
GTTGGCCTTGCTGACCGAACCGGATCTGGCCCAGTTGGCGCGGCGCGGTTCGCGCCTGTTCGAATCGTTC
CGCCTGGACGAGCTGAAGCATGACTACGCCGCGCTGACGGCGGGCTCCGAAGAGGCGGGTCAGTCGGTGG
CGCTGGGCGACAGCCCGGCGGGCGACGCCGGGCAGGATGGCGCGGCCGCCGCGGCCGGCCTGTCCAAGAC
GCCGGCGCTGGACCAGTACACCGCCAACCTGACGGAAAGGGCGCGCGAGGGCAAGATCGACCCGGTGATC
GGCCGCGATGCCGAGATCCGCCAGATGATCGATATCCTGACCCGCCGCCGCCAGAACAATCCCATCCTGA
CCGGCGAAGCCGGCGTGGGCAAGACTGCGGTGGTGGAAGGGCTGGCGCTGCGCATCGTGGCGGGCGACGT
GCCGCCGGCACTGGCCGGCGTCGCGCTGCGCACGCTGGACATGGGCTTGCTGCAGGCTGGCGCCAGCGTC
AAGGGCGAATTCGAAAACCGTCTGAAGAATGTGATCGACGAGGTCAAACAGAGCTCCACGCCCATCATCC
TGTTCATCGACGAAGCCCACACCATGATAGGCGCGGGCGGGCAGGCCGGGCAGAACGATGCGGCCAACCT
GCTCAAGCCGGCGCTGGCGCGTGGCGAGCTGCGCACCATCGCCGCCACCACCTGGAGCGAATACAAGAAG
TACTTCGAGAAGGACGCCGCGCTGGCGCGCCGCTTCCAGGTCGTCAAGGTGGAAGAGCCCAGCGAGGAAC
TGGCCGCCAGCATGCTGCGCGGCATGGCGCCGCTGATGGAGCAGCATTTTGGCGTGCGCGTGCTGGACGA
GGCCATCGTCGCCGCGGCCCGCCTGTCGCACCGCTACATCAGCGGCCGCCAACTGCCGGACAAGGCCGTC
AGCGTGCTGGACACGGCCTGCGCGCGCGTGGCCCTGGGCCGCAGCGCCACGCCGGCGCTGATCGACGACG
CGCGCCACCGCCTGGCGCGCCTGGAGACCGAGCGTGCTGCCCTGCGCCGGGAAGCCGCGGCGGGCGCGGC
ACAGTCCGCGCGCCTGCGCGAACTGGACCTGGAAATGGACGCCACGCGCGCCGCGCTGACGGACGCGGAA
GCGCGGCTGGCGCAGGAAAGCGAGCTGGTCAGGCAGATCCACGCGCTGCGCGAGGAGCTGGAGGCGGCGG
GCGCGGACGCCGCGCCAGAGCCCGCCGGCAAGCGCCGCTCGGGCAAGGCGGCCGAACCCGCCGCCACGCC
CGGCCAGGCGCAACTGGCCGAATTGCAGCAGCAGCTGCGCGCCTTGCAGGGCGAGGCGCCGCTGGTGCCC
GCCTTCGTGGACGCACAGGTCATCGCCGAGATCGTGTCGGCCTGGACCGGCATTCCGCTGGGCCGCATGG
TCAACGACGAAATCCGCACGGTGCTGGAACTGCAGCCCCTGCTGGCCGAGCGCGTCATCGGCCAGGACCA
TGCACTGCACGCCATCGCCCAGCGCGTGCGCACCGCGCGCGCCGGCCTGGAAGATCCCAACAAGCCCAAG
GGCGTGTTCCTCTTCATCGGCCCCTCGGGCGTGGGCAAGACCGAAACCGCGCTGGCCGTGGCGGATGTGC
TGTACGGCGGTGAACGCAAGCTGGTCACCATCAACATGAGCGAGTACCAGGAGGCCCATAGCGTATCGGG
CCTGAAGGGCTCGCCGCCGGGCTACGTGGGCTACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCCGC
CAGCCCTACAGCGTGGTGCTGCTGGACGAGATCGAGAAGGCCCATCCGGACGTGCTGGAGTTGTTCTTCC
AGGTGTTCGACAAGGGCGTGATGGATGACGCCGAAGGGCGCGAGATCGATTTCCGCAACACGCTCATCAT
CCTGACGTCCAACGTCGGCTCGTCGGCCATCATGCAGGCTTGCCTGAACAAGAGCGTCGAAGAGCGGCCC
GACCCCGAGGCCTTGCAGGAACTGTTGACGCCGCAGCTGTACAAGGCCTTCAAGCCCGCCTTCCTGGGCC
GCATGAAGACCATTGCCTACTACCCGGTGGATGACGACGCGCTGGCCCGCATCATCGGGCTGAAGCTCGG
GCGTATCGCGCAGCGGGTCCAGGCCAACCACCGCGCCCTGTTCGAATGGGATGAGGCGCTGGTGGAGGCC
GTGCTGGCGCGTTGCACCGAGGTGGATACCGGCGCGCGCAATGTGGACCACATCCTCAACGGCACGCTGT
TGCCGCAGATCGCCGAGCAGGTGCTGGGCCGCATGGCACAAGGGGAGGCCATTGCCCGCATCCGCGTGAC
TGCCGGCAAGAACGGCGACTTCCGCTATCGCCTTGCCTGA