SecReT6
Protein ID: 311108849
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05688
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6111538..6112620 [-]
Producthypothetical protein
NoteTssG
UniProt IDE3HG84
KEGG IDaxy:AXYL_05688
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-92, Aligned region: 15..341
Protein Sequence: 360 a.a.     [Download]
>gi|311108849|ref|YP_003981702.1| hypothetical protein AXYL_05688 [Achromobacter xylosoxidans A8]
MQRRRDPSVIESLLAEPQRFKFFQAVRVLESWFARQEGSRARNAVPAHLRFLNSSSLAFPASEIAALTAY
DKQGQALEDTESRLAALAAGNLGRVEIEPAFFGLLGAQGAMPLHYTEILSTRESSRRDRGARAFFDIFSN
RAAALFYAAWKKYRMPVRHETEQDHHYLPLLLALGGIGHPALRDRLQSGQGRVFDESLAHYAAAARQRPV
SAAYLQRVLADYFQVALRVEQFVGRWYHVPPQNRTQLGMPGAVLGVSAMAGDRIWQRDMRIRLWIGPLSK
EAFTDFLPGGARAQALEKLLTMFGGMSFEYEVRLVMAKEDVGGSVLGEGGGARLGWNSFLCTEAVASDRD
DASYELHTIH
 
Nucleotide Sequence: 1083 bp     [Download]
>ref|NC_014640.1|:c6112620-6111538 hypothetical protein AXYL_05688 [Achromobacter xylosoxidans A8]
ATGCAACGGCGACGCGATCCTAGCGTAATCGAATCACTGCTGGCCGAGCCGCAGCGCTTCAAGTTCTTCC
AGGCCGTGCGGGTGCTGGAGTCGTGGTTCGCCCGGCAGGAAGGCAGCCGCGCGCGCAATGCCGTGCCCGC
GCACCTGCGTTTCCTGAATTCGTCGTCGCTGGCTTTTCCCGCCAGCGAGATCGCGGCGCTGACGGCCTAT
GACAAGCAGGGCCAGGCGCTGGAGGACACCGAGTCAAGATTGGCGGCGCTGGCGGCAGGCAACCTGGGCC
GGGTGGAAATCGAGCCGGCGTTCTTCGGCCTGTTGGGCGCGCAGGGCGCCATGCCGCTGCATTACACCGA
GATCCTGAGCACCCGCGAAAGCTCGCGGCGCGACCGTGGCGCGCGCGCCTTCTTCGATATCTTCTCCAAC
CGGGCGGCGGCGCTGTTTTACGCTGCCTGGAAAAAGTACCGCATGCCCGTGCGGCACGAGACCGAACAGG
ACCATCACTACCTGCCGCTGCTGCTGGCGTTGGGAGGCATAGGCCATCCGGCGCTGCGCGACCGCCTGCA
ATCGGGACAGGGCCGGGTGTTCGACGAATCGCTGGCGCACTACGCCGCGGCGGCGCGCCAGCGGCCGGTT
TCGGCGGCTTATCTGCAACGCGTGCTGGCGGACTATTTCCAGGTGGCGCTGCGGGTGGAGCAATTCGTCG
GGCGCTGGTATCACGTACCGCCGCAGAACCGCACGCAGCTGGGCATGCCTGGCGCGGTGCTGGGCGTCTC
CGCCATGGCCGGCGACCGCATCTGGCAACGCGACATGCGCATCCGGCTGTGGATCGGCCCTCTGTCCAAA
GAGGCGTTCACGGACTTCCTGCCCGGCGGCGCGCGCGCCCAGGCGCTGGAGAAGCTCCTGACCATGTTCG
GCGGCATGAGCTTCGAGTACGAGGTGCGGCTGGTGATGGCCAAGGAAGACGTGGGCGGCAGCGTGCTGGG
CGAAGGCGGCGGCGCGCGCCTGGGTTGGAATTCCTTTCTTTGCACCGAGGCCGTGGCGTCCGACCGCGAC
GACGCCAGCTACGAACTGCACACCATTCATTAA