SecReT6
Protein ID: 311108850
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05689
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6112593..6114431 [-]
Producthypothetical protein
NoteTssF
UniProt IDE3HG85
KEGG IDaxy:AXYL_05689
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.70E-211, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|311108850|ref|YP_003981703.1| hypothetical protein AXYL_05689 [Achromobacter xylosoxidans A8]
MEELLPYYERELGFLRGSSRDFAQRYPKIAARLGLSGETCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALFEVMYPHYLRPFPSCSVAQFDMGGMASQLTAPVRMARGTELKSHPVRGVACRFRTAYDVTLAPVSI
RQAVFAATANAPSAASLPAGVTGRLSLTLACLAETQNFSNLAVDRLRVYLHGEPSFVAALRDCLFLRTAA
AYLETQPGRWNRMQDVPLAEVGLSEDEALIDFPASSHPAYRLLAEYFAFSEKFNFVDIDLAALRRAAGPV
REFTLHLALKGVRADSNTARLLESASSDNFRLGCTPVVNLFAQRADPIRVTHAQASYPVVADARRAYGYE
IYSIDRVRQVRQNAQGDSVVEFRPFYSLHHGETPDGASHYWTARRNSMVAERSPGYEMELSIVDIDFDPS
LPQTETLSLELTCTNRDLPAHLAVGQPGGDLFLEGGSIAREIRMLRRPTHTHRFQQGRAAHWRLISHLAL
NHLSLVHSGLPALKETLRLYDLSHSAVAARQIEGLVGLDYKPATHWMPGEPFATFVRGIEIRLTINEDNF
VGTSLHAFVAVINRFFGLYVHANSFVQLVVLSRRGADEILRCAPCNGDAILA
 
Nucleotide Sequence: 1839 bp     [Download]
>ref|NC_014640.1|:c6114431-6112593 hypothetical protein AXYL_05689 [Achromobacter xylosoxidans A8]
ATGGAAGAACTGCTGCCTTACTACGAACGCGAACTGGGTTTTCTGCGCGGTTCGTCGCGCGATTTTGCGC
AGCGCTATCCCAAGATCGCCGCGCGGCTCGGGCTGTCCGGCGAAACCTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCCCTGCTGGGCGCGCGCATCAACAAGAAGCTGGACGACGACTATCCGGAGTTC
ACGGAAGCGCTGTTCGAGGTGATGTATCCGCACTACCTGCGCCCGTTCCCCTCGTGCTCGGTGGCGCAGT
TCGATATGGGCGGCATGGCCTCGCAGCTGACCGCGCCCGTGCGCATGGCGCGCGGCACGGAACTGAAATC
GCACCCCGTGCGCGGCGTCGCGTGCCGTTTCCGCACGGCATACGACGTGACTCTGGCGCCGGTGAGCATC
CGCCAGGCGGTGTTCGCCGCCACGGCCAACGCGCCGTCGGCGGCCAGCCTGCCGGCAGGGGTGACGGGCC
GGCTGTCGCTGACACTGGCCTGCCTGGCCGAGACGCAGAACTTTTCAAACCTGGCGGTGGACCGCCTGCG
CGTCTACCTGCATGGCGAGCCCTCGTTCGTGGCCGCGCTGCGGGACTGTCTGTTCCTGCGCACGGCTGCG
GCCTATCTGGAAACGCAGCCGGGCCGCTGGAACCGCATGCAGGACGTGCCGCTGGCAGAGGTGGGGCTGT
CCGAGGACGAAGCCCTGATCGACTTCCCGGCCAGCTCGCATCCCGCCTACCGGCTGCTGGCCGAGTACTT
CGCGTTCTCCGAGAAATTCAATTTCGTCGACATCGATCTGGCGGCGCTGCGGCGCGCGGCGGGTCCGGTG
CGCGAATTCACGCTGCACCTGGCGTTGAAGGGCGTGCGCGCCGACTCGAATACGGCGCGTCTGCTGGAAT
CGGCCTCGTCCGACAACTTCCGGCTGGGCTGCACGCCCGTCGTCAATCTGTTCGCGCAGCGCGCCGACCC
CATCCGCGTCACCCATGCGCAGGCCTCCTATCCGGTGGTGGCAGACGCGCGCCGCGCCTATGGCTACGAG
ATTTATTCGATCGACCGCGTGCGCCAGGTACGGCAGAACGCGCAGGGCGATTCGGTGGTGGAGTTCCGGC
CCTTCTATTCGCTGCATCATGGCGAGACGCCCGATGGCGCCAGCCATTACTGGACCGCGCGGCGCAATTC
CATGGTGGCCGAGCGCAGCCCCGGCTACGAAATGGAACTGTCCATCGTGGACATCGATTTCGATCCCTCG
CTGCCGCAGACCGAGACCCTGAGCCTGGAGCTGACATGCACCAACCGCGACCTGCCCGCGCATCTGGCGG
TGGGGCAGCCGGGCGGCGACCTGTTCCTGGAAGGCGGTTCGATCGCGCGCGAAATCCGCATGCTGCGCCG
GCCCACGCACACGCACCGCTTTCAGCAGGGACGGGCGGCGCACTGGCGGCTCATTTCCCACTTGGCGCTG
AACCATCTGTCGCTGGTGCATAGCGGTCTGCCCGCGCTGAAGGAAACGCTGCGGCTGTATGACCTGTCGC
ATTCCGCGGTGGCGGCGCGCCAGATAGAAGGGCTGGTCGGACTGGACTACAAGCCCGCCACGCACTGGAT
GCCTGGCGAGCCCTTCGCGACCTTCGTGCGCGGCATTGAAATCCGGCTGACGATCAACGAAGACAACTTC
GTCGGCACCAGCCTGCATGCCTTCGTGGCGGTGATCAACCGCTTCTTCGGCCTTTACGTGCACGCCAACA
GCTTCGTGCAGCTGGTCGTGCTGTCGCGCCGCGGCGCGGACGAAATCCTACGGTGCGCTCCATGCAACGG
CGACGCGATCCTAGCGTAA