SecReT6
Protein ID: 311108851
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05690
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6114486..6114974 [-]
Producttype VI secretion system, lysozyme-related family protein 1
NoteTssE
UniProt IDE3HG86
KEGG IDaxy:AXYL_05690
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.60E-20, Aligned region: 29..135
Protein Sequence: 162 a.a.     [Download]
>gi|311108851|ref|YP_003981704.1| type VI secretion system, lysozyme-related family protein 1 [Achromobacter xylosoxidans A8]
MKGFEPSLFDKLFDGDGQTPHALRRLSVEEIKETVARDIEALLNTRMVFTEDSLKRYPNCQRSILTYGLS
DFSGLSLASHYDREFICRSLEQAIARHEPRLTHVRVLLQVDSRATSVLYFAITAMLDVGPAHEPVTFDAT
LQPSTLQYSVSKGRAKAAAAAA
 
Nucleotide Sequence: 489 bp     [Download]
>ref|NC_014640.1|:c6114974-6114486 type VI secretion system, lysozyme-related family protein 1 [Achromobacter xylosoxidans A8]
ATGAAGGGATTCGAACCCAGCCTGTTCGACAAGCTGTTCGACGGGGACGGGCAGACACCGCATGCGCTGC
GACGCCTGTCGGTGGAAGAAATCAAGGAAACGGTCGCGCGCGACATCGAGGCCCTGCTCAATACGCGCAT
GGTCTTCACCGAAGACTCGCTCAAGCGCTATCCGAATTGCCAGCGGTCCATCCTGACCTATGGTCTGTCG
GATTTTTCCGGCCTGAGCCTGGCCAGCCACTACGACCGCGAGTTCATTTGCCGGTCGCTGGAGCAGGCGA
TCGCCCGCCATGAGCCGCGCCTGACGCATGTGCGGGTGTTGCTGCAGGTGGACAGCCGCGCGACCTCGGT
GCTGTATTTCGCGATTACCGCCATGCTGGACGTGGGGCCTGCCCACGAGCCAGTGACGTTCGACGCGACG
CTGCAGCCGTCGACCTTGCAGTACTCGGTGAGCAAGGGCCGGGCCAAGGCCGCGGCCGCCGCCGCCTGA