SecReT6
Protein ID: 311108852
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05691
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6115037..6115540 [-]
Producttype VI secretion system effector, Hcp1 family protein
NoteTssD
UniProt IDE3HG87
KEGG IDaxy:AXYL_05691
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-41, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|311108852|ref|YP_003981705.1| type VI secretion system effector, Hcp1 family protein [Achromobacter xylosoxidans A8]
MKDIYVKFGNPALKGESQDKDHPDWIEVGSWRHEIIQPRSATASTSGGHTAERTEHGEMVFTKDLDVVSP
LLYQHASGGTTFDEVTIDFLRADGEGNRVKYLEIKLKYVIISRVAPEVVSEGLPHESFSLKYAAVQWKYT
QQKVGGNQGGNAQGAWSLTKNDKTYSV
 
Nucleotide Sequence: 504 bp     [Download]
>ref|NC_014640.1|:c6115540-6115037 type VI secretion system effector, Hcp1 family protein [Achromobacter xylosoxidans A8]
ATGAAGGACATCTACGTCAAATTCGGCAATCCCGCACTCAAGGGCGAGTCGCAGGACAAAGACCATCCGG
ACTGGATCGAAGTCGGATCGTGGCGCCATGAGATCATCCAGCCGCGTTCGGCTACCGCCTCCACCTCCGG
TGGCCATACCGCCGAGCGCACCGAGCACGGCGAGATGGTCTTCACCAAGGACCTGGACGTGGTCAGCCCG
CTGCTGTATCAGCACGCGTCCGGCGGCACCACCTTCGACGAAGTGACCATCGATTTCCTGCGCGCCGACG
GCGAAGGCAATCGCGTCAAGTACCTGGAAATCAAGCTCAAGTACGTGATCATCTCGCGCGTGGCGCCGGA
AGTCGTCAGCGAAGGCCTGCCGCACGAATCGTTCTCGCTGAAGTACGCCGCGGTGCAGTGGAAGTACACG
CAGCAGAAGGTGGGCGGCAACCAGGGCGGTAATGCCCAGGGCGCATGGAGCCTCACCAAGAACGACAAGA
CGTACTCGGTCTGA