SecReT6
Protein ID: 311108854
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05693
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6117067..6117591 [-]
Producthypothetical protein
NoteTssB
UniProt IDE3HG89
KEGG IDaxy:AXYL_05693
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.00E-58, Aligned region: 11..166
Protein Sequence: 174 a.a.     [Download]
>gi|311108854|ref|YP_003981707.1| hypothetical protein AXYL_05693 [Achromobacter xylosoxidans A8]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVGDFSAQSEAELPRLKDRKFVNIDVDNF
DDVMRGLEPRAAYRVKNRLTDEGGTFGVDLKFRSVEDFRPEAVVQQIEPLKELLDIRTKLADLRNKLAGN
DKLEDLLGEVLSSTEKLQQLTSEAGKNGKGGSNE
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_014640.1|:c6117591-6117067 hypothetical protein AXYL_05693 [Achromobacter xylosoxidans A8]
ATGGCTAAGAAAGAAAGCGTTCAGAAAAGACTCCAGAAAGTACGTCCGCCGCGCGTGCAGCTGACCTATG
ACGTCGAAAAGGGCGACGCGATCGAGCAGAAGGAACTGCCTTTCGTCGTGGGCGTGGTCGGCGATTTCAG
CGCGCAGTCCGAAGCCGAACTGCCGCGCCTGAAGGACCGCAAGTTCGTCAACATCGACGTCGACAACTTC
GACGACGTGATGCGCGGCCTGGAACCGCGCGCCGCCTACCGCGTGAAGAACCGCCTGACCGACGAAGGCG
GCACCTTCGGCGTGGACCTGAAGTTCCGTTCGGTCGAGGACTTCCGCCCGGAAGCGGTGGTGCAGCAGAT
CGAGCCGCTCAAGGAGCTCCTGGACATCCGCACCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTGGAAGACCTGCTGGGTGAAGTGCTCAGCAGCACGGAAAAACTGCAGCAACTGACCAGCGAAG
CCGGCAAGAACGGCAAGGGAGGCAGCAATGAGTAA